|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G14723.1 | AT | JGI | N/A | IEA |
|
Glyma.11g001600 not represented in the dataset |
Glyma.11g001600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.01g242700 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
>Glyma.11g001600.1 sequence-type=CDS polypeptide=Glyma.11g001600.1.p locus=Glyma.11g001600 ID=Glyma.11g001600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTGTGGAGAAAGGAGATACTTCATACTAGAGAATGATGATCACAGTGTCAACCCTGTCTTGACCATTTCCTTTAACAGAGATCTACGTACAGAAAGGAAAGCAAATCCAAGGTTAGGTTCATTTCCAGCAACATGTCAACCAAAGTGCAACCAATGCAAGCCTTGTGTGCCAGTCGAGGTGACTATCAAAACAATGGCAGAGGAAGAGAACGAGTACTATCCCATAGCGTGGATGTGTACGTGCCAGAGCAACATTTTTTCACCTTAG
>Glyma.11g001600.1.p sequence-type=predicted peptide transcript=Glyma.11g001600.1 locus=Glyma.11g001600 ID=Glyma.11g001600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MCGERRYFILENDDHSVNPVLTISFNRDLRTERKANPRLGSFPATCQPKCNQCKPCVPVEVTIKTMAEEENEYYPIAWMCTCQSNIFSP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||