SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.11G019200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.11G019200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.11G019200

Feature Type:gene_model
Chromosome:Gm11
Start:1353056
stop:1355103
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G23730.1AT Galactose mutarotase-like superfamily protein JGI N/AIEA
GO:0005975GO-bp carbohydrate metabolic process EnsemblGenomesN/AIEA
GO:0005975GO-bp carbohydrate metabolic process JGI N/AIEA
GO:0003824GO-mf catalytic activity EnsemblGenomesN/AIEA
GO:0016853GO-mf isomerase activity EnsemblGenomesN/AIEA
GO:0016853GO-mf isomerase activity JGI N/AIEA
GO:0030246GO-mf carbohydrate binding EnsemblGenomesN/AIEA
PTHR11122Panther APOSPORY-ASSOCIATED PROTEIN C-RELATED JGI N/AIEA
PF01263PFAM Aldose 1-epimerase JGI N/AIEA
PWYQT-4466SoyCyc9 superpathway of sucrose and starch metabolism I (non-photosynthetic tissue) Plant Metabolic Network ISS
GN7V-64791SoyCyc9-rxn glucose-6-phosphate 1-epimerase Plant Metabolic Network ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.11G019200 not represented in the dataset

Glyma.11G019200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


ParalogEvidenceComments
Glyma.01g223900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.11g019200 Wm82.a4.v1ISS As supplied by JGI
Glyma11g02160 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.11g019200.1 sequence-type=CDS polypeptide=Glyma.11g019200.1.p locus=Glyma.11g019200 ID=Glyma.11g019200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAAGACAACTTCTGGAGGAGGAGGAGGAGTAGGAGCAGCAGAAAGTGATAACAGAACTGCCACCGTGGGAATTGAATTTACCAAAGACAAGAATGGAATATCCCTACTCGTTCTTCGAAACCACCGTGGAGCTTCAGCAACTGTTAGTTTGCACGGAGGCCAGGTTCTTTCCTGGAAAACAGAACTTGGTGAGGAGTTACTCTTCATAAGTAACAAGGGTCTCTTTGGCAACAGATGGCAATCTAACTTGACATCTCGCATCAGGAATGTCAATGGCAAGAATTTCAGTTTTTCCATGGCCTATCATACATATTTCTCCATTTCAGATATAATATATAAATATATTGTATGTAGTGAAGTGAGGGTAGAAGGGTTGGAAACTCTTGACTACCTGGACAACCTGTACCAGAGAGAACGCTTCACAGAACAAGGAGATTCTCTGACATTTGAATCAGAGGTAGACCGGGTCTATTTTGATTCTAGCAATATTGTAATTGTTCTAGACCATGAAAAGAAGAGAACATTTGTGATACGAAAGGAAGGACTTCCGGATGTTGTTGTTTGGAATCCTTGGGAAAGAAAATCCAAGTCCATATTAGATTTAGGGGATGAAGAGTACAAACAGATGCTATGTGTTGATGGTGCAGCAGTTGAAAAACCAAATCACCTTGTGGCCAGGTGA

>Glyma.11g019200.1.p sequence-type=predicted peptide transcript=Glyma.11g019200.1 locus=Glyma.11g019200 ID=Glyma.11g019200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MKTTSGGGGGVGAAESDNRTATVGIEFTKDKNGISLLVLRNHRGASATVSLHGGQVLSWKTELGEELLFISNKGLFGNRWQSNLTSRIRNVNGKNFSFSMAYHTYFSISDIIYKYIVCSEVRVEGLETLDYLDNLYQRERFTEQGDSLTFESEVDRVYFDSSNIVIVLDHEKKRTFVIRKEGLPDVVVWNPWERKSKSILDLGDEEYKQMLCVDGAAVEKPNHLVAR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo