SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.10g292200

Feature Type:gene_model
Chromosome:Gm10
Start:51006927
stop:51009538
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.10g292200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G55120.1AT Chalcone-flavanone isomerase family protein JGI N/AIEA
GO:0009813GO-bp flavonoid biosynthetic process EnsemblGenomesN/AIEA
GO:0080167GO-bp response to karrikin EnsemblGenomesN/AIEA
GO:0005783GO-cc endoplasmic reticulum EnsemblGenomesN/AIEA
GO:0016853GO-mf isomerase activity EnsemblGenomesN/AIEA
GO:0016872GO-mf intramolecular lyase activity EnsemblGenomesN/AIEA
GO:0016872GO-mf intramolecular lyase activity JGI N/AIEA
GO:0045430GO-mf chalcone isomerase activity EnsemblGenomesN/AIEA
PF02431PFAM Chalcone-flavanone isomerase JGI N/AIEA
PWY-2002SoyCyc9 isoflavonoid biosynthesis I Plant Metabolic Network ISS
PWY-6325SoyCyc9 echinatin biosynthesis Plant Metabolic Network ISS
PWY-6787SoyCyc9 flavonoid biosynthesis (in equisetum) Plant Metabolic Network ISS
PWY1F-FLAVSYNSoyCyc9 flavonoid biosynthesis Plant Metabolic Network ISS
GN7V-47138SoyCyc9-rxn chalcone isomerase Plant Metabolic Network ISS

Proteins Associated with Glyma.10g292200
LocusGene SymbolProtein Name
CHI1B2 chalcone isomerase 1B2

Expression Patterns of Glyma.10g292200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.10g292200
ParalogEvidenceComments
Glyma.20g241600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.10g292200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma10g43850 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.10g292200
>Glyma.10g292200.1 sequence-type=CDS polypeptide=Glyma.10g292200.1.p locus=Glyma.10g292200 ID=Glyma.10g292200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCCACACCAGCATCCATCACCAATGTCACTGTGGAGTTCCTTCAATTCCCCGCGGTGGTGACACCTCCTGCCTCTACCAAATCCTATTTCCTTGGTGGCGCAGGGGTGAGAGGGTTGAATATTGAAGAAGAATTTGTAAAGTTCACGGGAATAGGTGTTTATTTGGAAGACAAGGCCGTGTCATCACTCGGTGCCAAATGGAAGGGCAAAAGTGCAGCTGAATTGCTGGACTCACTTGACTTCTACAGAGATATCATCAAAGGTCCGTTTGAGAAGTTAATTCGAGGGTCAAAGTTAAGAACATTGGATGGTCGTGAATACGTAAGGAAGGTGTCAGAGAACTGTGTGGCCCATATGGAATCCGTTGGGACTTACAGTGAAGCAGAAGAAAAAGCTATTGAGGAATTTAGAAATGCTTTCAAGGATCAAAATTTCCCACCAGGCTCCACTGTTTTCTACAAACAATCACCCACTGGAACATTGGGGCTTAGTTTCTCGAAAGATGAGACAATACCAGAACATGAGCATGCAGTGATAGACAACAAACCACTCTCGGAGGCCGTTCTGGAGACTATGATCGGAGAGATTCCTGTTTCCCCTGCTTTAAAAGAGAGTTTGGCTACAAGGTTTCACCAGTTTTTCAAAGAGTTAGAGGCCAATCCCAACAATGAAAACTGA
Predicted protein sequences of Glyma.10g292200
>Glyma.10g292200.1.p sequence-type=predicted peptide transcript=Glyma.10g292200.1 locus=Glyma.10g292200 ID=Glyma.10g292200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MATPASITNVTVEFLQFPAVVTPPASTKSYFLGGAGVRGLNIEEEFVKFTGIGVYLEDKAVSSLGAKWKGKSAAELLDSLDFYRDIIKGPFEKLIRGSKLRTLDGREYVRKVSENCVAHMESVGTYSEAEEKAIEEFRNAFKDQNFPPGSTVFYKQSPTGTLGLSFSKDETIPEHEHAVIDNKPLSEAVLETMIGEIPVSPALKESLATRFHQFFKELEANPNNEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo