Glyma.10g248900

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.10g248900

Feature Type:	gene_model
Chromosome:	Gm10
Start:	47715012
stop:	47716895
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.10g248900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G32150.1	AT	Haloacid dehalogenase-like hydrolase (HAD) superfamily protein	JGI	N/A	IEA
KOG3109	KOG	Haloacid dehalogenase-like hydrolase	JGI	N/A	IEA
PTHR12725	Panther	HALOACID DEHALOGENASE-LIKE HYDROLASE	JGI	N/A	IEA
PTHR12725:SF15	Panther		JGI	N/A	IEA
PWY-7204	SoyCyc9	pyridoxal 5'-phosphate salvage II (plants)	Plant Metabolic Network		ISS
GN7V-65036	SoyCyc9-rxn	pyridoxal phosphatase	Plant Metabolic Network		ISS

Proteins Associated with Glyma.10g248900

Locus	Gene Symbol	Protein Name
	NOD33	putative nod33

Expression Patterns of Glyma.10g248900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.10g248900 not represented in the dataset	Glyma.10g248900 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.10g248900

Paralog	Evidence	Comments
Glyma.20g144800	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.10g248900 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma10g39451	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.10g248900

Limit To All Plant Sequences

>Glyma.10g248900.1 sequence-type=CDS polypeptide=Glyma.10g248900.1.p locus=Glyma.10g248900 ID=Glyma.10g248900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGAATTGTCCAACAATTAATTCAAAACACACCGGAATTGACAAGTGCGTCAAGAAAAACATCCAACTCTTTCTCATCCAGAAATGCGGATTCTCAGAATCCAAAGCCTTGACCCAACGAGTTGAGCTCTTCAAAACCTACGGAAGCACCCTTGCCGGCTTAAGAGCACAAGGCCTCGATATCACTGCAGAGGACTACCACGGTTTCGTGCACGGAAGGCTACCTTACGACTCCATCGACACTGATCATCAGTTACGGAACCTCCTCTTGAGCATCAAACAAAGAAAAATTGTTTTTACTAATTCTGACAGGATTCACGCGATGAGGGCGCTGGATAGGCTTGGGGTCAAGGACTGTTTCGAGCAAATCATATGCTTCGAGACTATAAACCCGAACCTTCCCTATTCAACCCGACCCGACGAATTCCCCATCCTCCTTAAACCTTCGCTCGACGCCTTCAAGATCGCGCTTGACGCTGCCAACGTGGATCCTCGTCGTACGATTTTATGCTATATATTGCAGTTGTTTCTGGATGACAGCGTTCGCAATATTGCCGCGGGAAAAGAAATGGGTCTCCACACTGTTCTGGTTGGGAAGACAATGAAAAGCAAAGGAGCTGACTATGCTGTGGAGAGTGTGCATAACTTGGCACAAGTGATCCCAGAGATATGGGCAAACGAAATGGACGGTGGTGATCCAACGATGACACGTTCGAAGAGTGAATTGGAGGCCGTACTCGCTTGTGCTCTGGTTGGAGCTTGA

Predicted protein sequences of Glyma.10g248900

Limit To All Plant Sequences

>Glyma.10g248900.1.p sequence-type=predicted peptide transcript=Glyma.10g248900.1 locus=Glyma.10g248900 ID=Glyma.10g248900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MNCPTINSKHTGIDKCVKKNIQLFLIQKCGFSESKALTQRVELFKTYGSTLAGLRAQGLDITAEDYHGFVHGRLPYDSIDTDHQLRNLLLSIKQRKIVFTNSDRIHAMRALDRLGVKDCFEQIICFETINPNLPYSTRPDEFPILLKPSLDAFKIALDAANVDPRRTILCYILQLFLDDSVRNIAAGKEMGLHTVLVGKTMKSKGADYAVESVHNLAQVIPEIWANEMDGGDPTMTRSKSELEAVLACALVGA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain