Report for Sequence Feature Glyma.10g187000
Feature Type: gene_model
Chromosome: Gm10
Start: 42017270
stop: 42017713
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.10g187000
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G23230.1 AT
Integrase-type DNA-binding superfamily protein
JGI N/A IEA
GO:0006351 GO-bp
transcription, DNA-templated
EnsemblGenomes N/A IEA
GO:0006355 GO-bp
regulation of transcription, DNA-templated
EnsemblGenomes N/A IEA
GO:0006355 GO-bp
regulation of transcription, DNA-templated
JGI N/A IEA
GO:0005634 GO-cc
nucleus
EnsemblGenomes N/A IEA
GO:0003677 GO-mf
DNA binding
EnsemblGenomes N/A IEA
GO:0003700 GO-mf
DNA binding transcription factor activity
EnsemblGenomes N/A IEA
GO:0003700 GO-mf
sequence-specific DNA binding transcription factor activity
JGI N/A IEA
PF00847 PFAM
AP2 domain
JGI N/A IEA
Proteins Associated with Glyma.10g187000
Locus Gene Symbol Protein Name
ERF84 Ethylene-responsive factor gene 84
Expression Patterns of Glyma.10g187000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.10g187000
Paralog Evidence Comments
Glyma.20g203500 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.10g187000 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma10g33080 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.10g187000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.10g187000.1 sequence-type=CDS polypeptide=Glyma.10g187000.1.p locus=Glyma.10g187000 ID=Glyma.10g187000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGATGAAGAAGGGTCAAGGGGGAGGGCCAAGGAGGACGCCGGAGATGTCCGGTACCGGGGGGTCCGGCGGCGGCCCTGGGGGAAGTTCGCGGCGGAGATTCGAGACTCGACGAGGCAGGGTCAGAGGGTGTGGCTGGGGACTTTCAACACGGCGGAGGAAGCGGCCAGAGCCTATGATAGAGCTGCTTATACCATGAGAGGTCCATTTGCAATCCTTAACTTTCCTGATGAGTACCCTGTGACTGCTGCTGGTGCCACTAATGCTGCCACTTATTCTTCTGCTTCATCATCATCATCCTTGGCCTCTTCTTCTCGGCATGCCGATGTGGAAGCTAGAGGAAGAAGTGAGCAAGGAAGAGAAGTGTTTGAGTTTGAGTACTTGGATGATAAGTTGTTGGAGGAGCTTCTTGATTGTGAGAACAAAAAGAAAAGAGGACCCTGA
Predicted protein sequences of Glyma.10g187000
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.10g187000.1.p sequence-type=predicted peptide transcript=Glyma.10g187000.1 locus=Glyma.10g187000 ID=Glyma.10g187000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MDEEGSRGRAKEDAGDVRYRGVRRRPWGKFAAEIRDSTRQGQRVWLGTFNTAEEAARAYDRAAYTMRGPFAILNFPDEYPVTAAGATNAATYSSASSSSSLASSSRHADVEARGRSEQGREVFEFEYLDDKLLEELLDCENKKKRGP*