Glyma.10g134700

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.10g134700

Feature Type:	gene_model
Chromosome:	Gm10
Start:	36101524
stop:	36103559
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.10g134700

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G04040.1	AT	HAD superfamily, subfamily IIIB acid phosphatase	JGI	N/A	IEA
GO:0016311	GO-bp	dephosphorylation	EnsemblGenomes	N/A	IEA
GO:0003993	GO-mf	acid phosphatase activity	EnsemblGenomes	N/A	IEA
GO:0003993	GO-mf	acid phosphatase activity	JGI	N/A	IEA
PTHR11726	Panther	60S RIBOSOMAL PROTEIN L10	JGI	N/A	IEA
PTHR11726:SF1	Panther		JGI	N/A	IEA
PF03767	PFAM	HAD superfamily, subfamily IIIB (Acid phosphatase)	JGI	N/A	IEA
PWY-6348	SoyCyc9	phosphate acquisition	Plant Metabolic Network		ISS
GN7V-64453	SoyCyc9-rxn	acid phosphatase	Plant Metabolic Network		ISS

Proteins Associated with Glyma.10g134700

Locus	Gene Symbol	Protein Name
	HAD1	acid phosphatase
	HAD3-1	acid phosphatase

Expression Patterns of Glyma.10g134700

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.10g134700

Paralog	Evidence	Comments
Glyma.20g085500	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.10g134700 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma10g27020	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.10g134700

Limit To All Plant Sequences

>Glyma.10g134700.1 sequence-type=CDS polypeptide=Glyma.10g134700.1.p locus=Glyma.10g134700 ID=Glyma.10g134700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGGAAAACACTTTGGTCCTTTGTGGTTTTCACATGCCTTTTGATTCCTCTAGCAGTTGCAGATTGGAACATACTGAAGCTGCAGACACAAGATGGATTGAAGATCAGCCTGAAGAACTATTGTGAAAGCTGGAGGATGAATGCGGAGCTGCACAACATTAGGGACTTCCAAGTTGTGCCTGAAGAGTGCACTGAATACATAGGAAAATATGTTAAGTCCACACAGTACAAAGTAGACTCACAGAGGGCATCTGAAGAGTGCTTGGTTTACCTTAGCACCAGCTGTAATTTGAAGAAAGATGGATTCGATGCTTGGATTTTTGACATTGATGATACCCTGCTTTCAACTGTTCCTTACTACAAGAATAATCTATATGGGGGAAAGAAACTGAATGTGACATCTCTAGAGGAATGGATGCGCAAAGGCAATGCACCTGCTCTTGATCACTCATTGAAGCTATACAATGAACTTAAATCCAGGGGTGTGCAAATCATTTTGGTTACTTCAAGGAAGGAGCATCTCAGATCAGCCACAATTGACAACCTTGTCAAAGTTGGTTATTATGGGTGGACTAAAATTGTCTTTAGAGATCCTGCTAATGAATTGGTGTCAGTGCAAAAGTACAAGTCTGATGTGCGAAGGCAAATAATAAATGAGGGTTATCGCATTTGGGGCATTGTTGGGGACCAATACAGTAGCATTGAGGGGATTCCAAACCCCAGAAGGGCATTTAAACTCCCAAATCCGATGTACTATGTTGCCTAA

Predicted protein sequences of Glyma.10g134700

Limit To All Plant Sequences

>Glyma.10g134700.1.p sequence-type=predicted peptide transcript=Glyma.10g134700.1 locus=Glyma.10g134700 ID=Glyma.10g134700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGKTLWSFVVFTCLLIPLAVADWNILKLQTQDGLKISLKNYCESWRMNAELHNIRDFQVVPEECTEYIGKYVKSTQYKVDSQRASEECLVYLSTSCNLKKDGFDAWIFDIDDTLLSTVPYYKNNLYGGKKLNVTSLEEWMRKGNAPALDHSLKLYNELKSRGVQIILVTSRKEHLRSATIDNLVKVGYYGWTKIVFRDPANELVSVQKYKSDVRRQIINEGYRIWGIVGDQYSSIEGIPNPRRAFKLPNPMYYVA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain