SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.10g109600

Feature Type:gene_model
Chromosome:Gm10
Start:25429292
stop:25431378
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.10g109600
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G36160.1AT acetyl-CoA carboxylase 1 JGI N/AIEA
GO:0006633GO-bp fatty acid biosynthetic process EnsemblGenomesN/AIEA
GO:0006633GO-bp fatty acid biosynthetic process JGI N/AIEA
GO:0003989GO-mf acetyl-CoA carboxylase activity EnsemblGenomesN/AIEA
GO:0003989GO-mf acetyl-CoA carboxylase activity JGI N/AIEA
GO:0005524GO-mf ATP binding EnsemblGenomesN/AIEA
GO:0005524GO-mf ATP binding JGI N/AIEA
PTHR25871Panther JGI N/AIEA
PTHR25871:SF6Panther JGI N/AIEA
PF00364PFAM Biotin-requiring enzyme JGI N/AIEA
PF08326PFAM Acetyl-CoA carboxylase, central region JGI N/AIEA
PWY-7388SoyCyc9 octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) Plant Metabolic Network ISS
PWY0-1264SoyCyc9 biotin-carboxyl carrier protein assembly Plant Metabolic Network ISS
GN7V-48703SoyCyc9-rxn acetyl-CoA carboxylase Plant Metabolic Network ISS

Expression Patterns of Glyma.10g109600
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.10g109600 not represented in the dataset
Glyma.10g109600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.10g109600 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma10g15062 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.10g109600
>Glyma.10g109600.1 sequence-type=CDS polypeptide=Glyma.10g109600.1.p locus=Glyma.10g109600 ID=Glyma.10g109600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCCTCCCATCTCTGTGTGGCTATATGATAGTCATGTTGATGCTGACACACCGTATGCTGAAGTTGAGGTCATGAAAATGTGCATGCCTCTTCTTTCGCTTGCATCTGGGATTATTCATTTCAAAATGTCTGAAGGTCAAGCAATGCAGGCTGGTGAACTTATAGCAAGGCTTCATCTGGATGATCCTTCAGCTATAAGAAAGGCAGAACCCTTCACTGGGAGCTTCCCAGTTCTGGGACATCCTACTGCAATTTCTGGTAAAGTTCATCATAAATGCGTTGCAAGCTTAAATGTTGCACGGATGATTCTTTCTGGGTATGACCACAATATTGATGAAGGAATCAAGAGTAAAAATAAGCTGATCTTGCAACTAATGGATAAATTGCGTTCTTCAACAACGACGGTCGTTCCACGACATGTCTTTATAGCTTCCTTCAACAACGACGGGTGTACATGA
Predicted protein sequences of Glyma.10g109600
>Glyma.10g109600.1.p sequence-type=predicted peptide transcript=Glyma.10g109600.1 locus=Glyma.10g109600 ID=Glyma.10g109600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MPPISVWLYDSHVDADTPYAEVEVMKMCMPLLSLASGIIHFKMSEGQAMQAGELIARLHLDDPSAIRKAEPFTGSFPVLGHPTAISGKVHHKCVASLNVARMILSGYDHNIDEGIKSKNKLILQLMDKLRSSTTTVVPRHVFIASFNNDGCT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo