|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G44860.1 | AT | Ribosomal protein L24e family protein | JGI | N/A | IEA |
| GO:0000027 | GO-bp | ribosomal large subunit assembly | EnsemblGenomes | N/A | IEA |
| GO:0006412 | GO-bp | translation | EnsemblGenomes | N/A | IEA |
| GO:1902626 | GO-bp | assembly of large subunit precursor of preribosome | EnsemblGenomes | N/A | IEA |
| GO:0022625 | GO-cc | cytosolic large ribosomal subunit | EnsemblGenomes | N/A | IEA |
| GO:0003723 | GO-mf | RNA binding | EnsemblGenomes | N/A | IEA |
| GO:0003735 | GO-mf | structural constituent of ribosome | EnsemblGenomes | N/A | IEA |
| KOG1723 | KOG | 60s ribosomal protein L30 isolog | JGI | N/A | IEA |
| PTHR10792 | Panther | 60S RIBOSOMAL PROTEIN L24 | JGI | N/A | IEA |
| PTHR10792:SF3 | Panther | JGI | N/A | IEA | |
| PF01246 | PFAM | Ribosomal protein L24e | JGI | N/A | IEA |
|
Glyma.10g080100 not represented in the dataset |
Glyma.10g080100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma10g09802 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.10g080100.1 sequence-type=CDS polypeptide=Glyma.10g080100.1.p locus=Glyma.10g080100 ID=Glyma.10g080100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAGATTGGAGAAATGCTGGTTTTGCTCTTCAACCATATACCCTGGACATGGAATCCAGTTTGTTCGTAATGATGCAAAGATTTTTCGGTTTTGTAGATCTAAATGCCACAAGAACTTTAAAATGAAGAGAAATCCTCGTAAGGACTCAACTTTTGAGTTTGAGAGAAAGAGAAATAGGCCTGAAAGATATGACAGGAATCTTGCGGAGAATGTCCTCAAGGCCATTCCTAAGATTGATAAGATCAGAGTCTCGAGGGAGGAGAGACACCATAAGAACAATTTGGTCAAAGCTCGTTATGTGCTTCAACAGGATCCATCTCTCACTTTACCAAAGATCAAAGTCAAGGTTTCCCAACAGCAATCAGAGGAGAATCATGCCATGGAAGAGTAA
>Glyma.10g080100.1.p sequence-type=predicted peptide transcript=Glyma.10g080100.1 locus=Glyma.10g080100 ID=Glyma.10g080100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKDSTFEFERKRNRPERYDRNLAENVLKAIPKIDKIRVSREERHHKNNLVKARYVLQQDPSLTLPKIKVKVSQQQSEENHAMEE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||