Glyma.10g072300

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.10g072300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.10g072300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.10g072300

Feature Type:	gene_model
Chromosome:	Gm10
Start:	7323262
stop:	7326739
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.10g072300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G36230.1	AT	Aldolase-type TIM barrel family protein	JGI	N/A	IEA
GO:0000105	GO-bp	histidine biosynthetic process	EnsemblGenomes	N/A	IEA
GO:0000105	GO-bp	histidine biosynthetic process	JGI	N/A	IEA
GO:0000162	GO-bp	tryptophan biosynthetic process	EnsemblGenomes	N/A	IEA
GO:0008152	GO-bp	metabolic process	EnsemblGenomes	N/A	IEA
GO:0008652	GO-bp	cellular amino acid biosynthetic process	EnsemblGenomes	N/A	IEA
GO:0005737	GO-cc	cytoplasm	EnsemblGenomes	N/A	IEA
GO:0003824	GO-mf	catalytic activity	EnsemblGenomes	N/A	IEA
GO:0003949	GO-mf	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase activity	EnsemblGenomes	N/A	IEA
PTHR21169	Panther	1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)METHYLIDENEAMINO] IMIDAZOLE-4-CARBOXAMIDE ISOMERASE	JGI	N/A	IEA
PF00977	PFAM	Histidine biosynthesis protein	JGI	N/A	IEA
HISTSYN-PWY	SoyCyc9	L-histidine biosynthesis	Plant Metabolic Network		ISS
GN7V-46554	SoyCyc9-rxn	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.10g072300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.10g072300 not represented in the dataset	Glyma.10g072300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.10g072300

Paralog	Evidence	Comments
Glyma.13g153700	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.10g072300 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma10g08461	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.10g072300

Limit To All Plant Sequences

>Glyma.10g072300.1 sequence-type=CDS polypeptide=Glyma.10g072300.1.p locus=Glyma.10g072300 ID=Glyma.10g072300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCCACTACACATCTACTTGAAGAAAAGAATTAATTTTCAACCACTTAGTATACACGGTTGTCTGCAAGTTGGAGGGGGAATAAATTCTGACAATTGTTTGAGTTGCATTGAAGAAGGAGCAAGCCATGTCATTGTGACATCTTATGTATTCAATAATGGACAAATGGATCTTGAAAGGCTAAAAGATCTTGTTCAAATTGTTGGAAAAGAGAGGCTTGTGTTGGATCTCAGTTGCAGAAAAAAAAGTTCAGTGATGTTTTTTGTTGATCCTCATGTGACGGAATTTCTTGCCAACTTTGCTGATGAGTTTCTGGTTCATGGTGTTGATGTTGAAGGGAAGAAGTTGAGAATTGATGAAGAGCTTGTGGCTTGCTTTGGCAAATATTCACCGATTCCTGTTACTTATGCTGGTGGTGTGACTGAAATGGCTGATCTAGAGAGGATAAAAACTGCCGGGTTGGACGGTGTGAATGTTACTGTGGGCAGTGCCTTGGATAGCATTTGCCTTCAAGAGGTTGTAGCTTGA

Predicted protein sequences of Glyma.10g072300

Limit To All Plant Sequences

>Glyma.10g072300.1.p sequence-type=predicted peptide transcript=Glyma.10g072300.1 locus=Glyma.10g072300 ID=Glyma.10g072300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MPLHIYLKKRINFQPLSIHGCLQVGGGINSDNCLSCIEEGASHVIVTSYVFNNGQMDLERLKDLVQIVGKERLVLDLSCRKKSSVMFFVDPHVTEFLANFADEFLVHGVDVEGKKLRIDEELVACFGKYSPIPVTYAGGVTEMADLERIKTAGLDGVNVTVGSALDSICLQEVVA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain