Report for Sequence Feature Glyma.10g049500
| Feature Type: | gene_model |
| Chromosome: | Gm10 |
| Start: | 4418747 |
| stop: | 4419252 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.10g049500
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT4G29300.1 | AT |
LCR27 |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.10g049500 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma10g05665 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.10g049500
>Glyma.10g049500.1 sequence-type=CDS polypeptide=Glyma.10g049500.1.p locus=Glyma.10g049500 id=Glyma.10g049500.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAAAGTGTCCTTGAGGCCCTGTTTCCTATTGGCGATTATTTTGCCAATTTTTTCAATTTTGATGGTGTCACAAACGGTTGCGAATCATACTTGCAGTTTAATAGTGTACTATTCAGATAAATGTGATATAGTGAGTTGTACAAACGCCTGCGTGGACTATACTGGATTCTATACAGCTGCTGGACTATGCTTCCCAGATGGATGCCATTGCGAATATGATTGTCCTCCTACAACTTTGTCTTAG
Predicted protein sequences of Glyma.10g049500
>Glyma.10g049500.1.p sequence-type=predicted peptide transcript=Glyma.10g049500.1 locus=Glyma.10g049500 id=Glyma.10g049500.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MKVSLRPCFLLAIILPIFSILMVSQTVANHTCSLIVYYSDKCDIVSCTNACVDYTGFYTAAGLCFPDGCHCEYDCPPTTLS*