SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.10g040200

Feature Type:gene_model
Chromosome:Gm10
Start:3547051
stop:3547805
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.10g040200
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43970.1AT translocase of outer membrane 22-V JGI N/AIEA
GO:0006886GO-bp intracellular protein transport EnsemblGenomesN/AIEA
GO:0030150GO-bp protein import into mitochondrial matrix EnsemblGenomesN/AIEA
GO:0045040GO-bp protein import into mitochondrial outer membrane EnsemblGenomesN/AIEA
GO:0005741GO-cc mitochondrial outer membrane EnsemblGenomesN/AIEA
GO:0005742GO-cc mitochondrial outer membrane translocase complex EnsemblGenomesN/AIEA
GO:0016020GO-cc membrane EnsemblGenomesN/AIEA
GO:0016021GO-cc integral component of membrane EnsemblGenomesN/AIEA
GO:0031307GO-cc integral component of mitochondrial outer membrane EnsemblGenomesN/AIEA
PTHR12504Panther MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM22 JGI N/AIEA

Expression Patterns of Glyma.10g040200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.10g040200
ParalogEvidenceComments
Glyma.13g126900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.10g040200 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma10g04590 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.10g040200
>Glyma.10g040200.1 sequence-type=CDS polypeptide=Glyma.10g040200.1.p locus=Glyma.10g040200 ID=Glyma.10g040200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCGTCCCGAAGAGGTGGAGTCTCACTCCCAGAAAGACCAAGCAACAACTCAGGCTCCGTCCTGGCGAAGATCTCGCGCTCCTCCATCGTCACCCGCGGCAAGGAAGCCGCCGTCGACGCCGCATTCGTCGCCAAGAAGCTCCTCCGCAGCACCGGCAAGGCCGCGTGGATCGCCGGCACCACCTTCCTCGTCCTCGTCGTCCCTCTGATCGTCGAGATGGACCGCGAGCAGCAGCTCAACGACCTCGAGCTCCAGCAGGCCAGCCTCCTCGGCACCCCCGCCCCCAAATGA
Predicted protein sequences of Glyma.10g040200
>Glyma.10g040200.1.p sequence-type=predicted peptide transcript=Glyma.10g040200.1 locus=Glyma.10g040200 ID=Glyma.10g040200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASRRGGVSLPERPSNNSGSVLAKISRSSIVTRGKEAAVDAAFVAKKLLRSTGKAAWIAGTTFLVLVVPLIVEMDREQQLNDLELQQASLLGTPAPK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo