Report for Sequence Feature Glyma.10g035500
| Feature Type: | gene_model |
| Chromosome: | Gm10 |
| Start: | 3089500 |
| stop: | 3089990 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.10g035500
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT2G31280.4 | AT |
CPUORF7 |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.10g035500 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.10g035500
>Glyma.10g035500.1 sequence-type=CDS polypeptide=Glyma.10g035500.1.p locus=Glyma.10g035500 id=Glyma.10g035500.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGGTAGGGATCGGCTGCTATTGGCAACGGTTGGACCGCCATTAAAACGGCGTGCAGGGTTGCGGAGGAAGCAGGCTGGAAGAGGGTCTTATAGGGGAAGCTAA
Predicted protein sequences of Glyma.10g035500
>Glyma.10g035500.1.p sequence-type=predicted peptide transcript=Glyma.10g035500.1 locus=Glyma.10g035500 id=Glyma.10g035500.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MGRDRLLLATVGPPLKRRAGLRRKQAGRGSYRGS*