|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G74340.1 | AT | dolichol phosphate-mannose biosynthesis regulatory protein-related | JGI | N/A | IEA |
| GO:0006506 | GO-bp | GPI anchor biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0009059 | GO-bp | macromolecule biosynthetic process | JGI | N/A | IEA |
| GO:0019348 | GO-bp | dolichol metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0035269 | GO-bp | protein O-linked mannosylation | EnsemblGenomes | N/A | IEA |
| GO:0050790 | GO-bp | regulation of catalytic activity | EnsemblGenomes | N/A | IEA |
| GO:0005789 | GO-cc | endoplasmic reticulum membrane | EnsemblGenomes | N/A | IEA |
| GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
| GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
| GO:0030176 | GO-cc | integral component of endoplasmic reticulum membrane | EnsemblGenomes | N/A | IEA |
| GO:0030176 | GO-cc | integral component of endoplasmic reticulum membrane | JGI | N/A | IEA |
| GO:0033185 | GO-cc | dolichol-phosphate-mannose synthase complex | EnsemblGenomes | N/A | IEA |
| GO:0004582 | GO-mf | dolichyl-phosphate beta-D-mannosyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0030234 | GO-mf | enzyme regulator activity | EnsemblGenomes | N/A | IEA |
| KOG3488 | KOG | Dolichol phosphate-mannose regulatory protein (DPM2) | JGI | N/A | IEA |
| PTHR15039 | Panther | FAMILY NOT NAMED | JGI | N/A | IEA |
| PTHR15039:SF7 | Panther | JGI | N/A | IEA | |
| PF07297 | PFAM | Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) | JGI | N/A | IEA |
| MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS | SoyCyc9 | protein N-glycosylation initial phase (eukaryotic) | Plant Metabolic Network | ISS | |
| GN7V-65874 | SoyCyc9-rxn | dolichyl-phosphate β-D-mannosyltransferase | Plant Metabolic Network | ISS |
|
Glyma.10G041600 not represented in the dataset |
Glyma.10G041600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.13g128600 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.10g041600 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma10g04730 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.10g041600.1 sequence-type=CDS polypeptide=Glyma.10g041600.1.p locus=Glyma.10g041600 ID=Glyma.10g041600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAATTAGCAGACAGAGCTGTTGGATTTCTGTTATCCTTTATCAGCTTATCAATATTTACCTATTATACTTTCTGGGTTATCATCCTGCCATTTGTGGATGATGATCACTTTGTGCACAAGTACTTCTTACCCCAAGAGTATGCCATACTGATACCAGTTTCAGCTGGTGTGGCACTTCTTTGCCTCTTGTGCATATTTATTGGATTCGTGATGCTCAAATCCAAAAAGAAGAAGGCCTAA
>Glyma.10g041600.1.p sequence-type=predicted peptide transcript=Glyma.10g041600.1 locus=Glyma.10g041600 ID=Glyma.10g041600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MELADRAVGFLLSFISLSIFTYYTFWVIILPFVDDDHFVHKYFLPQEYAILIPVSAGVALLCLLCIFIGFVMLKSKKKKA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||