SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.10G013300

Feature Type:gene_model
Chromosome:Gm10
Start:1181771
stop:1183043
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.10G013300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G62420.1AT basic region/leucine zipper motif 53 JGI N/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated EnsemblGenomesN/AIEA
GO:0006355GO-bp regulation of transcription, DNA-templated JGI N/AIEA
GO:0003700GO-mf DNA binding transcription factor activity EnsemblGenomesN/AIEA
GO:0003700GO-mf sequence-specific DNA binding transcription factor activity JGI N/AIEA
GO:0043565GO-mf sequence-specific DNA binding JGI N/AIEA
PTHR22952Panther CAMP-RESPONSE ELEMENT BINDING PROTEIN-RELATED JGI N/AIEA
PTHR22952:SF61Panther JGI N/AIEA
PF00170PFAM bZIP transcription factor JGI N/AIEA

Proteins Associated with Glyma.10G013300
LocusGene SymbolProtein Name
BZIP59 bZIP transcription factor bZIP59
bZIP73 Basic leucine zipper transcription factor-like protein gene 73

Expression Patterns of Glyma.10G013300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.10G013300
ParalogEvidenceComments
Glyma.02g012700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.10G013300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g013300 Wm82.a4.v1ISS As supplied by JGI
Glyma10g01640 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.10G013300
>Glyma.10g013300.1 sequence-type=CDS polypeptide=Glyma.10g013300.1.p locus=Glyma.10g013300 ID=Glyma.10g013300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTTCGATTCCGCGTCCGGCGAGTTCGGGATCTTCGGAGGGAGGAGGAGATCCGGCTGCGATGGACGAGAGAAAGAGGAAGCGGATGGAGTCGAACCGCGAGTCCGCACGGCGATCGCGGATGAAGAAGCAGAAGCTGCTCGAAGACCTATCCGACGTAGCGAGTCGCCTTCAAGGCGAGAACGTGCGCTTAGCGCAGAGCATAAAGGCGAAGGAGGAAGCGTACGTTGAGATCGAAGCCGCGAACGACATCCTCAGAGCACAGACCATGGAACTCGCCGACCGGTTAAGGTTTCTGAACTCCATTCTCGAGATCGCCGATGAGGTCGGCGGCGGTGGTGAATCCTTCGAGATTCCGCAGATTCCAGACCCTCTCTTCATGCCCTGGCAGATCCCCCACCCTATGATGGCGTCACCTGACATGCTCCTCCATGGAAATCAAGGCCTGTTTGCTTGA
Predicted protein sequences of Glyma.10G013300
>Glyma.10g013300.1.p sequence-type=predicted peptide transcript=Glyma.10g013300.1 locus=Glyma.10g013300 ID=Glyma.10g013300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MASIPRPASSGSSEGGGDPAAMDERKRKRMESNRESARRSRMKKQKLLEDLSDVASRLQGENVRLAQSIKAKEEAYVEIEAANDILRAQTMELADRLRFLNSILEIADEVGGGGESFEIPQIPDPLFMPWQIPHPMMASPDMLLHGNQGLFA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo