SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.10G000100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.10G000100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.10G000100

Feature Type:gene_model
Chromosome:Gm10
Start:2633
stop:9035
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.10G000100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G62310.1AT transcription factor jumonji (jmjC) domain-containing protein JGI N/AIEA
GO:0006412GO-bp translation EnsemblGenomesN/AIEA
GO:0009234GO-bp menaquinone biosynthetic process EnsemblGenomesN/AIEA
GO:0005840GO-cc ribosome EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome EnsemblGenomesN/AIEA
GO:0030976GO-mf thiamine pyrophosphate binding EnsemblGenomesN/AIEA
GO:0070204GO-mf 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase activity EnsemblGenomesN/AIEA
PTHR12549Panther JMJC DOMAIN-CONTAINING HISTONE DEMETHYLATION PROTEIN JGI N/AIEA

Expression Patterns of Glyma.10G000100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.10G000100 not represented in the dataset
Glyma.10G000100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Gene model name correspondences to Glyma.10G000100 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.10g000100 Wm82.a4.v1ISS As supplied by JGI


Coding sequences of Glyma.10G000100
>Glyma.10g000100.1 sequence-type=CDS polypeptide=Glyma.10g000100.1.p locus=Glyma.10g000100 ID=Glyma.10g000100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCAGGGGGAAATTAATATCCACCAATTTTTTACTGGCTATACAAATGGTCGTAGGGATTGGCTTGCTTGGCCACAGATATTGAAATTAAAAGATTGGCCTCCTTCTAATTTATTTGAGGAACAATTGCCTCGTCATTGTGCTGAGTTCATATCTTCCTTACCCTTCAAGGAATATACTGATCCTCACAAAGGTTCTCTTAACCTTGCTGTGAAGTTGCCTAATGGTTCTCTAAAGCCAGACCTGGGGCCAAAAACATATATTGCTTATGGATTTCTTCAGGAGCTTGGACGTGGTGATTCAGTGACTAAGCTCCATTGTGATATGTCTGATGCAGTAAATGTGTTGACTCATATTGCTGAAGTGAAACTGGATTCTGATCAACTTACTGTCATTGAGAAGTTGAAGCAAAAGCATCTCGAGCAAGAGAAAAGGGAGCTACTTGGCGATGATCAGGATGGAGAAACTAATGTTGACATGCTTAATAATTCATCTTCTACAATAAATGCTTTGGACAGGCAAAGTAGTGTTGAAGTCATGGAACAAGAAGGTGGATTATGTGATGGGAAAGAAGTTGATCAGTTTCATCAACCGTCTGGTAGTAATGAGGTTGCCATTGCTAATGAGGATGGTATTTCATATGGATCAGAGCTCATAGAGGTTGACAAAGTAAAAATAAATCAAGGTGATTTGTTGTTTGGGGGGATGCTTCAGATGGTGCTCTCTGGGATATTTTTCGGAGACAGGATGTCCCTAAGTTGCAGGAATATCTGA
Predicted protein sequences of Glyma.10G000100
>Glyma.10g000100.1.p sequence-type=predicted peptide transcript=Glyma.10g000100.1 locus=Glyma.10g000100 ID=Glyma.10g000100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MQGEINIHQFFTGYTNGRRDWLAWPQILKLKDWPPSNLFEEQLPRHCAEFISSLPFKEYTDPHKGSLNLAVKLPNGSLKPDLGPKTYIAYGFLQELGRGDSVTKLHCDMSDAVNVLTHIAEVKLDSDQLTVIEKLKQKHLEQEKRELLGDDQDGETNVDMLNNSSSTINALDRQSSVEVMEQEGGLCDGKEVDQFHQPSGSNEVAIANEDGISYGSELIEVDKVKINQGDLLFGGMLQMVLSGIFFGDRMSLSCRNI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo