SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.09g262400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.09g262400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.09g262400

Feature Type:gene_model
Chromosome:Gm09
Start:48007388
stop:48014923
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.09g262400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G45790.1AT phosphomannomutase JGI N/AIEA
GO:0006013GO-bp mannose metabolic process EnsemblGenomesN/AIEA
GO:0006487GO-bp protein N-linked glycosylation EnsemblGenomesN/AIEA
GO:0009298GO-bp GDP-mannose biosynthetic process EnsemblGenomesN/AIEA
GO:0019307GO-bp mannose biosynthetic process JGI N/AIEA
GO:0045047GO-bp protein targeting to ER EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm EnsemblGenomesN/AIEA
GO:0005737GO-cc cytoplasm JGI N/AIEA
GO:0005829GO-cc cytosol EnsemblGenomesN/AIEA
GO:0004615GO-mf phosphomannomutase activity EnsemblGenomesN/AIEA
GO:0004615GO-mf phosphomannomutase activity JGI N/AIEA
GO:0016853GO-mf isomerase activity EnsemblGenomesN/AIEA
KOG3189 KOG Phosphomannomutase JGI N/AIEA
PTHR10466Panther PHOSPHOMANNOMUTASE JGI N/AIEA
PF03332PFAM Eukaryotic phosphomannomutase JGI N/AIEA
PWY-5659SoyCyc9 GDP-mannose biosynthesis Plant Metabolic Network ISS
PWY-882SoyCyc9 L-ascorbate biosynthesis I (L-galactose pathway) Plant Metabolic Network ISS
GN7V-60768SoyCyc9-rxn phosphomannomutase Plant Metabolic Network ISS

Expression Patterns of Glyma.09g262400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.09g262400 not represented in the dataset
Glyma.09g262400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.09g262400
ParalogEvidenceComments
Glyma.18g229800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.09g262400 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma09g39800 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.09g262400
>Glyma.09g262400.1 sequence-type=CDS polypeptide=Glyma.09g262400.1.p locus=Glyma.09g262400 ID=Glyma.09g262400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTGCCAGGAGACCGGGTTTAATTGCTTTGTTTGATGTTGACGGGACTCTTACAGCTCCCAGGAAGGTGGTCACACCGGAAATGTTGACATTCATGCAAGAACTACGAAAGGTTGTAACGGTTGGAGTTGTTGGGGGTTCTGACCTTATAAAGATATCAGAGCAACTTGGCAGCACAGTTACCAATGAGTATGATTACGTATTTTCTGAGAATGGTCTTGTGGCTCACAAGGAAGGAAAGCTCATTGGAACTCAGAGCTTGAAGTCATTCCTTGGTGAAGAAAAGCTCAAGGAGTTTATTAACTTTACACTTCATTATATTGCTGATTTGGACATCCCCATTAAGAGGGGAACATTTATGGAGTTCCGTAGTGGGATGCTGAATGTGTCACCTATTGGCCGAAACTGTAGCCAAGAAGAAAGAGATGAGTTTGAGAAATATGACAAGGTTCACAACATACGCCCAAAAATGGTTTCTGTACTTCGTGAGAAGTTTGCTCATCTTAACTTGACATTCTCCATTGGAGGACAGATAAGTTTTGATGTTTTCCCTCAAGGTTGGGACAAAACATACTGCCTGAGATACCTTGATGGTTTCAATGAAATTCACTTCTTTGGTGACAAAACTTACAAGGGTGGAAATGACCATGAAATCTACGAATCTGAAAGGACTATTGGGCACACAGTTACAAGCCCTGATGATACAGTGAAGCAGTGTAAATCTCTGTTCCTAGAAAATTAA
Predicted protein sequences of Glyma.09g262400
>Glyma.09g262400.1.p sequence-type=predicted peptide transcript=Glyma.09g262400.1 locus=Glyma.09g262400 ID=Glyma.09g262400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MAARRPGLIALFDVDGTLTAPRKVVTPEMLTFMQELRKVVTVGVVGGSDLIKISEQLGSTVTNEYDYVFSENGLVAHKEGKLIGTQSLKSFLGEEKLKEFINFTLHYIADLDIPIKRGTFMEFRSGMLNVSPIGRNCSQEERDEFEKYDKVHNIRPKMVSVLREKFAHLNLTFSIGGQISFDVFPQGWDKTYCLRYLDGFNEIHFFGDKTYKGGNDHEIYESERTIGHTVTSPDDTVKQCKSLFLEN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo