Glyma.09g249200

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.09g249200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.09g249200): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.09g249200

Feature Type:	gene_model
Chromosome:	Gm09
Start:	47027538
stop:	47030542
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.09g249200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G16400.1	AT	thioredoxin F2	JGI	N/A	IEA
GO:0006662	GO-bp	glycerol ether metabolic process	EnsemblGenomes	N/A	IEA
GO:0045454	GO-bp	cell redox homeostasis	EnsemblGenomes	N/A	IEA
GO:0045454	GO-bp	cell redox homeostasis	JGI	N/A	IEA
GO:0055114	GO-bp	oxidation-reduction process	EnsemblGenomes	N/A	IEA
GO:0005623	GO-cc	cell	EnsemblGenomes	N/A	IEA
GO:0015035	GO-mf	protein disulfide oxidoreductase activity	EnsemblGenomes	N/A	IEA
KOG0907	KOG	Thioredoxin	JGI	N/A	IEA
PTHR10438	Panther	THIOREDOXIN	JGI	N/A	IEA
PTHR10438:SF15	Panther		JGI	N/A	IEA
PF00085	PFAM	Thioredoxin	JGI	N/A	IEA
GN7V-64846	SoyCyc9-rxn	monodehydroascorbate reductase (NADH)	Plant Metabolic Network		ISS

Expression Patterns of Glyma.09g249200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.09g249200 not represented in the dataset	Glyma.09g249200 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Paralogs of Glyma.09g249200

Paralog	Evidence	Comments
Glyma.18g243200	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.09g249200 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma09g38470	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.09g249200

Limit To All Plant Sequences

>Glyma.09g249200.1 sequence-type=CDS polypeptide=Glyma.09g249200.1.p locus=Glyma.09g249200 ID=Glyma.09g249200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGCTCTGAATCTTTGTATCTCACCTAACTGTAAATGGGTTTCATCTCCTGCTTCCTTAGATAGTGCATCTTCTTTGAGATCTTCACTTGGTTCTTGTTTTGGTAACATAAACATTGCTAGTGTGAGTTTAAGCACTAGTAGAAGTTTGAGTTTGAGGAGGAGTGGGAGTGTTAGTGTAAGATCTAGTTTGGAAACTACGGGGCCCACAGTTACAGTGGGACAGGTCACTGAGGTTAACAAGGATACCTTCTGGCCGATCGTTAAGGCTGCCGGGGATAAAACCGTTGTCCTTGACATGTACACACAATGGTGTGGCCCTTGCAAAGTGATGGCTCCAAAGTTTCAAGAATTATCTGAAAAGTATCTGGATGTTGTCTTTCTAAAGCTTGATTGCAACCAAGAGAACAGGCCCTTGGCAAAAGAGCTGGGAATTAACGTGGTTCCCACTTTTAAAATTCTGAAGGACAACAAGGTTGTAAAAGAAGTTACTGGAGCTAAATACGATGATTTGGTTGATGCCATTGACAAAGTTCGATCTAGCTAA

Predicted protein sequences of Glyma.09g249200

Limit To All Plant Sequences

>Glyma.09g249200.1.p sequence-type=predicted peptide transcript=Glyma.09g249200.1 locus=Glyma.09g249200 ID=Glyma.09g249200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MALNLCISPNCKWVSSPASLDSASSLRSSLGSCFGNINIASVSLSTSRSLSLRRSGSVSVRSSLETTGPTVTVGQVTEVNKDTFWPIVKAAGDKTVVLDMYTQWCGPCKVMAPKFQELSEKYLDVVFLKLDCNQENRPLAKELGINVVPTFKILKDNKVVKEVTGAKYDDLVDAIDKVRSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain