Report for Sequence Feature Glyma.09g220500
| Feature Type: | gene_model |
| Chromosome: | Gm09 |
| Start: | 45130555 |
| stop: | 45130828 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.09g220500
Gene model name correspondences to Glyma.09g220500 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.09g220500
>Glyma.09g220500.1 sequence-type=CDS polypeptide=Glyma.09g220500.1.p locus=Glyma.09g220500 id=Glyma.09g220500.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGGTTTTCATTTATTAGGTATCCGAAGGGCATCATCTGCTGCAAACCAATTAAAAATGAAGCCCTTTGTGATCCCTGTATCATACTTGAACCAACCTTCTTTCCAAGAGTTGTTGAGTCAAGTTGAGGAAGAGTTTGGATATGATCATCCCATGGGTTGTCTTACAATTCATTGCAGTGAAGATGTCTTCCAACATATAACTTATAGACTGACATAG
Predicted protein sequences of Glyma.09g220500
>Glyma.09g220500.1.p sequence-type=predicted peptide transcript=Glyma.09g220500.1 locus=Glyma.09g220500 id=Glyma.09g220500.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MGFHLLGIRRASSAANQLKMKPFVIPVSYLNQPSFQELLSQVEEEFGYDHPMGCLTIHCSEDVFQHITYRLT*