Report for Sequence Feature Glyma.09g215500
| Feature Type: | gene_model |
| Chromosome: | Gm09 |
| Start: | 44771926 |
| stop: | 44774546 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.09g215500
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| KOG4118 |
KOG |
Uncharacterized conserved protein |
JGI | N/A | IEA |
| PTHR21213 | PantherFam |
GEO09665P1-RELATED |
JGI | N/A | IEA |
| PF12874 | Pfam |
Zinc-finger of C2H2 type |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.09g215500 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma09g34905 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.09g215500
>Glyma.09g215500.1 sequence-type=CDS polypeptide=Glyma.09g215500.1.p locus=Glyma.09g215500 id=Glyma.09g215500.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGACGCGGGGAAAGCAGAAGATCGAAGCGCAGAAGCGAAACGCAGAGAGGAATCAGAAGGGAAAGGGCTCTCAGCTCGAGGCCAGAGCCGTTGGCCTCAAAGTCATCTGCCCCATCTGCAAGGCCCAACTTGCAAATCAAAACCAACTTGTTGATCATTATGCTTCCAAACATCCGAAGGAGAAACCCCCTGCAGAGACCAGTTAG
Predicted protein sequences of Glyma.09g215500
>Glyma.09g215500.1.p sequence-type=predicted peptide transcript=Glyma.09g215500.1 locus=Glyma.09g215500 id=Glyma.09g215500.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MTRGKQKIEAQKRNAERNQKGKGSQLEARAVGLKVICPICKAQLANQNQLVDHYASKHPKEKPPAETS*