|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG00120.1 | AT | ATP synthase subunit alpha | JGI | N/A | IEA |
GO:0046034 | GO-bp | ATP metabolic process | EnsemblGenomes | N/A | IEA |
GO:0046034 | GO-bp | ATP metabolic process | JGI | N/A | IEA |
GO:1902600 | GO-bp | proton transmembrane transport | EnsemblGenomes | N/A | IEA |
PTHR15184 | Panther | ATP SYNTHASE | JGI | N/A | IEA |
PTHR15184:SF25 | Panther | JGI | N/A | IEA | |
PF02874 | PFAM | ATP synthase alpha/beta family, beta-barrel domain | JGI | N/A | IEA |
PWY-7219 | SoyCyc9 | adenosine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
PWY-7229 | SoyCyc9 | superpathway of adenosine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS | |
PWY-841 | SoyCyc9 | superpathway of purine nucleotides de novo biosynthesis I | Plant Metabolic Network | ISS |
Glyma.09g171500 not represented in the dataset |
Glyma.09g171500 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma09g30185 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g171500.1 sequence-type=CDS polypeptide=Glyma.09g171500.1.p locus=Glyma.09g171500 ID=Glyma.09g171500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTAACCATTCGTGCAGGTGAAATTAGTAAAATTATCCGTGAACGCATTGAGCAATATAATACAGAAGTCAAAATTGTAAATACAGGTACCGTACTTCAAGTAGGCGACGATATTGCTCGTATTTATGGTCTTGATGAAGTAATGACGGGTGAATTAGTGGAATTTGAAGAGGGTACTATAGGCATTGCTTTGAATTTGGAATCCAAAAATGTTGGTGTTGTATTAATGGGTGATGGTTTGATGATACAAGAGGGAAGTTCAGTAAAAGCAACAAGAAGAATTGCTCAAATACTTGTAAGTGAGGCTTATTTGGGTCGTGTTATAAATGCCCTGGCTAAACCAATTGATGGTTGA
>Glyma.09g171500.1.p sequence-type=predicted peptide transcript=Glyma.09g171500.1 locus=Glyma.09g171500 ID=Glyma.09g171500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVTIRAGEISKIIRERIEQYNTEVKIVNTGTVLQVGDDIARIYGLDEVMTGELVEFEEGTIGIALNLESKNVGVVLMGDGLMIQEGSSVKATRRIAQILVSEAYLGRVINALAKPIDG*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||