|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
GO:0010466 | GO-bp | negative regulation of peptidase activity | EnsemblGenomes | N/A | IEA |
GO:0010951 | GO-bp | negative regulation of endopeptidase activity | EnsemblGenomes | N/A | IEA |
GO:0005576 | GO-cc | extracellular region | EnsemblGenomes | N/A | IEA |
GO:0005576 | GO-cc | extracellular region | JGI | N/A | IEA |
GO:0004867 | GO-mf | serine-type endopeptidase inhibitor activity | EnsemblGenomes | N/A | IEA |
GO:0004867 | GO-mf | serine-type endopeptidase inhibitor activity | JGI | N/A | IEA |
GO:0030414 | GO-mf | peptidase inhibitor activity | EnsemblGenomes | N/A | IEA |
PF00228 | PFAM | Bowman-Birk serine protease inhibitor family | JGI | N/A | IEA |
Locus | Gene Symbol | Protein Name |
---|---|---|
BBI | Bowman-Birk proteinase inhibitor |
Glyma.09g158900 not represented in the dataset |
Glyma.09g158900 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma09g28730 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g158900.1 sequence-type=CDS polypeptide=Glyma.09g158900.1.p locus=Glyma.09g158900 ID=Glyma.09g158900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTGGTGCTAAAGGTGTGTTTGGTGCTACTTTTCCTTGTGGGGGGTACTACTAGTGCCAACTTGAGGCTGAGTAAGCTTGGCCTGCTCATGAAAAGTGATCATCATCAACACTCAAATGATGATGAGTCTTCAAAACCATGCTGTGATCAATGCGCATGCACAAAGTCAAACCCTCCTCAATGCCGCTGTTCAGATATGAGGCTGAATTCGTGCCATTCAGCTTGCAAATCTTGTATTTGCGCATTATCGTATCCTGCACAGTGTTTTTGTGTTGACATAACCGATTTCTGCTATGAACCTTGCAAACCCAGTGAGGATGACAAGGAAAACTACTAA
>Glyma.09g158900.1.p sequence-type=predicted peptide transcript=Glyma.09g158900.1 locus=Glyma.09g158900 ID=Glyma.09g158900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVVLKVCLVLLFLVGGTTSANLRLSKLGLLMKSDHHQHSNDDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDKENY*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||