|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G01490.1 | AT | Heavy metal transport/detoxification superfamily protein | JGI | N/A | IEA |
GO:0030001 | GO-bp | metal ion transport | EnsemblGenomes | N/A | IEA |
GO:0030001 | GO-bp | metal ion transport | JGI | N/A | IEA |
GO:0046916 | GO-bp | cellular transition metal ion homeostasis | EnsemblGenomes | N/A | IEA |
GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
GO:0046872 | GO-mf | metal ion binding | JGI | N/A | IEA |
GO:0046914 | GO-mf | transition metal ion binding | EnsemblGenomes | N/A | IEA |
KOG1603 | KOG | Copper chaperone | JGI | N/A | IEA |
PF00403 | PFAM | Heavy-metal-associated domain | JGI | N/A | IEA |
Glyma.09g131200 not represented in the dataset |
Glyma.09g131200 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma09g24353 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g131200.1 sequence-type=CDS polypeptide=Glyma.09g131200.1.p locus=Glyma.09g131200 ID=Glyma.09g131200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTGATCGAGGGCATGTACAGAAAGTCATATTAAAGGTGGCCTTACATGATGATAGAATCAAGAAAAAAGCTATGAAGACAACATCTGGCCTTCCAGGGCTCGAATCAATTTCTATTGACGTTAATGACATGAAATTAGTCTTATTGGGGGACATTGATCCAGTGTCAAAGCTACGAAAGTGGTGCACACTGAATTAG
>Glyma.09g131200.1.p sequence-type=predicted peptide transcript=Glyma.09g131200.1 locus=Glyma.09g131200 ID=Glyma.09g131200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MADRGHVQKVILKVALHDDRIKKKAMKTTSGLPGLESISIDVNDMKLVLLGDIDPVSKLRKWCTLN*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||