Glyma.09g129000

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.09g129000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.09g129000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.09g129000

Feature Type:	gene_model
Chromosome:	Gm09
Start:	32327554
stop:	32330788
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.09g129000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G52840.1	AT	NADH-ubiquinone oxidoreductase-related	JGI	N/A	IEA
GO:0022904	GO-bp	respiratory electron transport chain	EnsemblGenomes	N/A	IEA
GO:0022904	GO-bp	respiratory electron transport chain	JGI	N/A	IEA
GO:0005743	GO-cc	mitochondrial inner membrane	EnsemblGenomes	N/A	IEA
GO:0005743	GO-cc	mitochondrial inner membrane	JGI	N/A	IEA
GO:0016651	GO-mf	oxidoreductase activity, acting on NAD(P)H	EnsemblGenomes	N/A	IEA
GO:0016651	GO-mf	oxidoreductase activity, acting on NAD(P)H	JGI	N/A	IEA
KOG3365	KOG	NADH:ubiquinone oxidoreductase, NDUFA5/B13 subunit	JGI	N/A	IEA
PTHR12653	Panther	NADH-UBIQUINONE OXIDOREDUCTASE 13 KD-B SUBUNIT	JGI	N/A	IEA
PF04716	PFAM	ETC complex I subunit conserved region	JGI	N/A	IEA
PWY-3781	SoyCyc9	aerobic respiration I (cytochrome c)	Plant Metabolic Network		ISS
PWY-4302	SoyCyc9	aerobic respiration III (alternative oxidase pathway)	Plant Metabolic Network		ISS
PWY-5083	SoyCyc9	NAD/NADH phosphorylation and dephosphorylation	Plant Metabolic Network		ISS
GN7V-60949	SoyCyc9-rxn	NADH:ubiquinone reductase (H⁺-translocating)	Plant Metabolic Network		ISS

Expression Patterns of Glyma.09g129000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.09g129000 not represented in the dataset	Glyma.09g129000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.09g129000 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma09g24070	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.09g129000

Limit To All Plant Sequences

>Glyma.09g129000.1 sequence-type=CDS polypeptide=Glyma.09g129000.1.p locus=Glyma.09g129000 ID=Glyma.09g129000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTTTCTGCGTGCGGTGGCGCGGCCGTTGATGGCGAAGGTGAAGGCTTCGACGGGGATCGTGGGGCTGGACGTGGTGCCGAACGCGAGGGAGGTGCTGATTGGGCTGTACAGCAAGACGCTGAAAGAGATCCAGAAGGTTCCCGAAGATGAAGGGTACCGCAAGGCCGTGGAGAGCTTCACCAAGCACAGGCTCGGCGTGTGCAAGGAGGAGGAGGACTGGGAGAACATCGAGAAACGCCTCGGCTGCGGCCAGGTCGAGGAGCTCATCGAAGAGGCTCAGGACGAGCTCAAGCTCATTTCCTACATGATCGAGTGGGATCCTTGGGGTGTTCCAGATGATTATGAATGTGAGGTGATTGAGAATGATGCACCAGTTCCCAAGCATGTTCCTCTCCACCGACCTCCTCCTCTCCCAACAGAATTTCACAAGACGCTAGAGGCACTTACAGGGAAAGATACTCCGGCTGCCAGCTCTAGTGAATCACCCTCAAAGGCATGA

Predicted protein sequences of Glyma.09g129000

Limit To All Plant Sequences

>Glyma.09g129000.1.p sequence-type=predicted peptide transcript=Glyma.09g129000.1 locus=Glyma.09g129000 ID=Glyma.09g129000.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MFLRAVARPLMAKVKASTGIVGLDVVPNAREVLIGLYSKTLKEIQKVPEDEGYRKAVESFTKHRLGVCKEEEDWENIEKRLGCGQVEELIEEAQDELKLISYMIEWDPWGVPDDYECEVIENDAPVPKHVPLHRPPPLPTEFHKTLEALTGKDTPAASSSESPSKA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain