|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G57000.1 | AT | nucleolar essential protein-related | JGI | N/A | IEA |
GO:0000462 | GO-bp | maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) | EnsemblGenomes | N/A | IEA |
GO:0070475 | GO-bp | rRNA base methylation | EnsemblGenomes | N/A | IEA |
GO:0005730 | GO-cc | nucleolus | EnsemblGenomes | N/A | IEA |
GO:0032040 | GO-cc | small-subunit processome | EnsemblGenomes | N/A | IEA |
GO:0008168 | GO-mf | methyltransferase activity | EnsemblGenomes | N/A | IEA |
GO:0008168 | GO-mf | methyltransferase activity | JGI | N/A | IEA |
GO:0019843 | GO-mf | rRNA binding | EnsemblGenomes | N/A | IEA |
GO:0070037 | GO-mf | rRNA (pseudouridine) methyltransferase activity | EnsemblGenomes | N/A | IEA |
PTHR12636 | Panther | NEP1/MRA1 | JGI | N/A | IEA |
PTHR12636:SF2 | Panther | JGI | N/A | IEA | |
PF03587 | PFAM | EMG1/NEP1 methyltransferase | JGI | N/A | IEA |
Glyma.09g120100 not represented in the dataset |
Glyma.09g120100 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma09g21291 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g120100.1 sequence-type=CDS polypeptide=Glyma.09g120100.1.p locus=Glyma.09g120100 ID=Glyma.09g120100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTAGGGGCAATATACGTTAAAATGGATCAACGAGGAGTGTTTGAAGTCAAACCACATGTTCGTATACCAAGAACGTGTAATCGATTCTGTGGTGTCATAATTCTTCTTCGTGTTGTTGAGGAACCTATAACACGCCATTTGCCTGTCAACTCTCACATAGTAGGTCTCTCTTATACTTCAGAAAAGTTGGTTGACATAGAGGAATATGTCTCAGTTTGGAGCAATGATTTGAGTCCTGTTTTTGTGGTAGGCACAATGGTGAATGGGAAAGTAAAAGGGGACTATATGCATGATTATATTTCAATTTCTGAATATCCACTTGCTGCTAAATACTGCCTAGGAATGATATGTGAAGCTTTGTAG
>Glyma.09g120100.1.p sequence-type=predicted peptide transcript=Glyma.09g120100.1 locus=Glyma.09g120100 ID=Glyma.09g120100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVGAIYVKMDQRGVFEVKPHVRIPRTCNRFCGVIILLRVVEEPITRHLPVNSHIVGLSYTSEKLVDIEEYVSVWSNDLSPVFVVGTMVNGKVKGDYMHDYISISEYPLAAKYCLGMICEAL*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||