|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G10900.1 | AT | Phosphatidylinositol-4-phosphate 5-kinase family protein | JGI | N/A | IEA |
| GO:0016310 | GO-bp | phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0046488 | GO-bp | phosphatidylinositol metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0046488 | GO-bp | phosphatidylinositol metabolic process | JGI | N/A | IEA |
| GO:0046854 | GO-bp | phosphatidylinositol phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0000166 | GO-mf | nucleotide binding | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| GO:0016301 | GO-mf | kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0016307 | GO-mf | phosphatidylinositol phosphate kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0016307 | GO-mf | phosphatidylinositol phosphate kinase activity | JGI | N/A | IEA |
| GO:0016740 | GO-mf | transferase activity | EnsemblGenomes | N/A | IEA |
| PTHR23086 | Panther | PHOSPHATIDYLINOSITOL-4-PHOSPHATE 5-KINASE | JGI | N/A | IEA |
| PTHR23086:SF6 | Panther | JGI | N/A | IEA | |
| PF01504 | PFAM | Phosphatidylinositol-4-phosphate 5-Kinase | JGI | N/A | IEA |
| PWY-6351 | SoyCyc9 | D-myo-inositol (1,4,5)-trisphosphate biosynthesis | Plant Metabolic Network | ISS | |
| PWY-6352 | SoyCyc9 | 3-phosphoinositide biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-64472 | SoyCyc9-rxn | 1-phosphatidylinositol-4-phosphate 5-kinase | Plant Metabolic Network | ISS |
|
Glyma.09g113600 not represented in the dataset |
Glyma.09g113600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma09g17646 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g113600.1 sequence-type=CDS polypeptide=Glyma.09g113600.1.p locus=Glyma.09g113600 ID=Glyma.09g113600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCCAGCTCAAGCTACTCGGAAGGTTGAGGAGGAGGTGGAGGCAAAAGAAGTAGAGCTTTTTGAGGTATATGATGTTGTCCTCTACATGGGCGTAATTGATATATTGCAGAACTATAATCTGAGAAAGAAAATTGAGCATGCATACAAATCACTGCAATTTGACCCTAAGACAATATTAGTAGTTGAACCCAAGATGTATGATGAACGTTTCATCAAATTTTTAGAGGAAAAAGTTTTCCCCGAGACCCCCTGA
>Glyma.09g113600.1.p sequence-type=predicted peptide transcript=Glyma.09g113600.1 locus=Glyma.09g113600 ID=Glyma.09g113600.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MPAQATRKVEEEVEAKEVELFEVYDVVLYMGVIDILQNYNLRKKIEHAYKSLQFDPKTILVVEPKMYDERFIKFLEEKVFPETP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||