|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G16300.1 | AT | glyceraldehyde-3-phosphate dehydrogenase of plastid 2 | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | JGI | N/A | IEA |
| GO:0016620 | GO-mf | oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor | EnsemblGenomes | N/A | IEA |
| GO:0016620 | GO-mf | oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor | JGI | N/A | IEA |
| PTHR10836 | Panther | GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASE | JGI | N/A | IEA |
| PF02800 | PFAM | Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain | JGI | N/A | IEA |
| GLUCONEO-PWY | SoyCyc9 | gluconeogenesis I | Plant Metabolic Network | ISS | |
| GLYCOLYSIS | SoyCyc9 | glycolysis I (from glucose 6-phosphate) | Plant Metabolic Network | ISS | |
| PWY-1042 | SoyCyc9 | glycolysis IV (plant cytosol) | Plant Metabolic Network | ISS | |
| PWY-5464 | SoyCyc9 | superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle | Plant Metabolic Network | ISS | |
| PWY-5484 | SoyCyc9 | glycolysis II (from fructose 6-phosphate) | Plant Metabolic Network | ISS | |
| PWY-7345 | SoyCyc9 | superpathway of anaerobic sucrose degradation | Plant Metabolic Network | ISS | |
| SUCSYN-PWY | SoyCyc9 | sucrose biosynthesis I (from photosynthesis) | Plant Metabolic Network | ISS | |
| GN7V-66521 | SoyCyc9-rxn | glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) | Plant Metabolic Network | ISS |
|
Glyma.09g099700 not represented in the dataset |
Glyma.09g099700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma09g15175 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g099700.1 sequence-type=CDS polypeptide=Glyma.09g099700.1.p locus=Glyma.09g099700 ID=Glyma.09g099700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCATTCCGTGTACCGACTCCTAATGTTTTTGTGGTGGACTTCACTTGCCGACTTAAGAAGAATGCTTCCTATGAAGATGTTAAAGCAGCAATAAAGTCAAGTATCTTTAATGCCATGGTTGGAATTGCACTAAGTGCTTCCTTTGTTAAGCTAGTTTCGTGCAACCGAGTATTGGACCTTATAGAGCACATGGCATTGGTTGGAGCTCAAAATGGAACACCATTAGTGTATGTTATGTTGCAATTGTTGTTGAATAGCGTTTAA
>Glyma.09g099700.1.p sequence-type=predicted peptide transcript=Glyma.09g099700.1 locus=Glyma.09g099700 ID=Glyma.09g099700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MAFRVPTPNVFVVDFTCRLKKNASYEDVKAAIKSSIFNAMVGIALSASFVKLVSCNRVLDLIEHMALVGAQNGTPLVYVMLQLLLNSV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||