Report for Sequence Feature Glyma.09g087100
| Feature Type: | gene_model |
| Chromosome: | Gm09 |
| Start: | 11089618 |
| stop: | 11089890 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.09g087100
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT1G20510.1 | AT |
OPCL1 |
JGI | N/A | IEA |
| PTHR24096 | PantherFam |
LONG-CHAIN-FATTY-ACID--COA LIGASE |
JGI | N/A | IEA |
| PF13193 | Pfam |
AMP-binding enzyme C-terminal domain |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.09g087100 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma09g10985 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.09g087100
>Glyma.09g087100.1 sequence-type=CDS polypeptide=Glyma.09g087100.1.p locus=Glyma.09g087100 id=Glyma.09g087100.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGCCAATGGCATATGTGGTGAGAGCAGCTGGTTCTGAACTCTCAGAAAACCAAGTCATTCAATTTGTTGCAGGCCAGGTGGCTCCATACAACAAAGTGAGAAAGATGAGTTTCATTGACACTATTCCAAAGTTAGCTGCTGGCAAGATATTGCAGAAGGATCTTGTTTCTCAAAGAAAATATCAACTTGTCTCCAAGTTATGA
Predicted protein sequences of Glyma.09g087100
>Glyma.09g087100.1.p sequence-type=predicted peptide transcript=Glyma.09g087100.1 locus=Glyma.09g087100 id=Glyma.09g087100.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MPMAYVVRAAGSELSENQVIQFVAGQVAPYNKVRKMSFIDTIPKLAAGKILQKDLVSQRKYQLVSKL*