Report for Sequence Feature Glyma.09g080600
| Feature Type: | gene_model |
| Chromosome: | Gm09 |
| Start: | 9269581 |
| stop: | 9271101 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.09g080600
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT5G13570.2 | AT |
ATDCP2,DCP2,TDT |
JGI | N/A | IEA |
| 3.6.1.62 | EC |
5'-(N7-methylguanosine 5'-triphospho)-[mRNA] hydrolase |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.09g080600 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma09g09501 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.09g080600
>Glyma.09g080600.1 sequence-type=CDS polypeptide=Glyma.09g080600.1.p locus=Glyma.09g080600 id=Glyma.09g080600.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGATACAACATTTGCTCTTCTTACCAAAAAGGAAATCAGTATCATTGAAATCATGGATTTCAACACACCAACCTTCTATGGCTCCAAGGCCCGATTTGCCTCTTAAAGGAATTTGCGTATGGAAAGCAAAACCCGGTTCTATTGGAAGTAGCTCAACAGTAATGGATATCCAGCCAACAAAACCTGAACCTGATTCTTACACCCCTGACCTGGACTAG
Predicted protein sequences of Glyma.09g080600
>Glyma.09g080600.1.p sequence-type=predicted peptide transcript=Glyma.09g080600.1 locus=Glyma.09g080600 id=Glyma.09g080600.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MIQHLLFLPKRKSVSLKSWISTHQPSMAPRPDLPLKGICVWKAKPGSIGSSSTVMDIQPTKPEPDSYTPDLD*