|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G13930.1 | AT | Chalcone and stilbene synthase family protein | JGI | N/A | IEA |
GO:0008152 | GO-bp | metabolic process | EnsemblGenomes | N/A | IEA |
GO:0009058 | GO-bp | biosynthetic process | EnsemblGenomes | N/A | IEA |
GO:0009058 | GO-bp | biosynthetic process | JGI | N/A | IEA |
GO:0003824 | GO-mf | catalytic activity | EnsemblGenomes | N/A | IEA |
GO:0016746 | GO-mf | transferase activity, transferring acyl groups | JGI | N/A | IEA |
GO:0016747 | GO-mf | transferase activity, transferring acyl groups other than amino-acyl groups | EnsemblGenomes | N/A | IEA |
PF00195 | PFAM | Chalcone and stilbene synthases, N-terminal domain | JGI | N/A | IEA |
PWY-6787 | SoyCyc9 | flavonoid biosynthesis (in equisetum) | Plant Metabolic Network | ISS | |
PWY1F-FLAVSYN | SoyCyc9 | flavonoid biosynthesis | Plant Metabolic Network | ISS | |
GN7V-52839 | SoyCyc9-rxn | naringenin-chalcone synthase | Plant Metabolic Network | ISS |
Glyma.09g074900 not represented in the dataset |
Glyma.09g074900 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma09g08751 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g074900.1 sequence-type=CDS polypeptide=Glyma.09g074900.1.p locus=Glyma.09g074900 ID=Glyma.09g074900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGTGAGTGTTGAAGAGATTCATAAGGCACAACGTGCAGAAGGCTCTGCCATCGTGATGGCTATTGGCACGGCCACTCCTCCCAACTGCGTGGATCAGAGTACCTATCCTGACTATTATCTTCGCATCACCAACAGTGACCACATGACCGAGCTCAAAGAAAAGTTCAAGCGCATGTGTGAGTGCAAGAGACATCCATTTATAGATGACTTTGAGAATAACATTACCTCACAAATTCAATGCTATTCCATCAAATTGCCAGCAACCAACCCTCTTGAGGGAATGGAATAA
>Glyma.09g074900.1.p sequence-type=predicted peptide transcript=Glyma.09g074900.1 locus=Glyma.09g074900 ID=Glyma.09g074900.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MVSVEEIHKAQRAEGSAIVMAIGTATPPNCVDQSTYPDYYLRITNSDHMTELKEKFKRMCECKRHPFIDDFENNITSQIQCYSIKLPATNPLEGME*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||