|
A previous version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G06520.1 | AT | photosystem II subunit X | JGI | N/A | IEA |
GO:0015979 | GO-bp | photosynthesis | EnsemblGenomes | N/A | IEA |
GO:0015979 | GO-bp | photosynthesis | JGI | N/A | IEA |
GO:0009523 | GO-cc | photosystem II | EnsemblGenomes | N/A | IEA |
GO:0009523 | GO-cc | photosystem II | JGI | N/A | IEA |
GO:0016020 | GO-cc | membrane | EnsemblGenomes | N/A | IEA |
GO:0016020 | GO-cc | membrane | JGI | N/A | IEA |
GO:0016021 | GO-cc | integral component of membrane | EnsemblGenomes | N/A | IEA |
PF06596 | PFAM | Photosystem II reaction centre X protein (PsbX) | JGI | N/A | IEA |
PHOTOALL-PWY | SoyCyc9 | oxygenic photosynthesis | Plant Metabolic Network | ISS | |
PWY-101 | SoyCyc9 | photosynthesis light reactions | Plant Metabolic Network | ISS | |
GN7V-67033 | SoyCyc9-rxn | photosystem II | Plant Metabolic Network | ISS |
Glyma.09g067700 not represented in the dataset |
Glyma.09g067700 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
Paralog | Evidence | Comments |
---|---|---|
Glyma.15g174200 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma09g07880 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g067700.1 sequence-type=CDS polypeptide=Glyma.09g067700.1.p locus=Glyma.09g067700 ID=Glyma.09g067700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCTTCCACTTCTGCAGTTTCAATGGTTATGCCGGTAACTTATGCCAGCCAGAAGAGAGTGGTGCCTAGCTCTGATGCATTCTTCAAGCCACTCACACTACGGTCCTCCAAGGTAGTGGCGGCATCAAATTCCAATGGAAGGTTTCAGGTGAGGACCTCCATGAAGGAGAAAGTTGTAACAGGGCTCACAGCAGCTGCATTGACAGCTTCAATGATGGTTCCTGATGTGGCTGAGGCTGCCGTCTCACCTTCTCTCAAGAACTTCTTGCTCAGCATCGCGGCAGGTGGAGTTGTTGTTGTTGCCATTATTGGTGCTGTGATCGGTGTTTCCAATTTCGATCCCGTCAAGCGAAGCTGA
>Glyma.09g067700.1.p sequence-type=predicted peptide transcript=Glyma.09g067700.1 locus=Glyma.09g067700 ID=Glyma.09g067700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MASTSAVSMVMPVTYASQKRVVPSSDAFFKPLTLRSSKVVAASNSNGRFQVRTSMKEKVVTGLTAAALTASMMVPDVAEAAVSPSLKNFLLSIAAGGVVVVAIIGAVIGVSNFDPVKRS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||