SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.09g064500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.09g064500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.09g064500

Feature Type:gene_model
Chromosome:Gm09
Start:6261387
stop:6263582
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.09g064500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56940.1AT Ribosomal protein S16 family protein JGI N/AIEA
GO:0006412GO-bp translation EnsemblGenomesN/AIEA
GO:0006412GO-bp translation JGI N/AIEA
GO:0032543GO-bp mitochondrial translation EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular JGI N/AIEA
GO:0005739GO-cc mitochondrion EnsemblGenomesN/AIEA
GO:0005840GO-cc ribosome EnsemblGenomesN/AIEA
GO:0005840GO-cc ribosome JGI N/AIEA
GO:0015935GO-cc small ribosomal subunit EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome JGI N/AIEA
KOG3419 KOG Mitochondrial/chloroplast ribosomal protein S16 JGI N/AIEA
PTHR12919Panther 30S RIBOSOMAL PROTEIN S16 JGI N/AIEA
PTHR12919:SF5Panther JGI N/AIEA
PF00886PFAM Ribosomal protein S16 JGI N/AIEA

Expression Patterns of Glyma.09g064500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.09g064500 not represented in the dataset
Glyma.09g064500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.09g064500
ParalogEvidenceComments
Glyma.15g170800 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.09g064500 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma09g07420 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.09g064500
>Glyma.09g064500.1 sequence-type=CDS polypeptide=Glyma.09g064500.1.p locus=Glyma.09g064500 ID=Glyma.09g064500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGGTGAGGATTAGGCTATCCCGGTTGGGGTGTAAGAACAAACCCTTCTATCGAGTTATGGCCGCTGATAGCAGATCACCAAGAGATGGCAAACACCTCGAAGTTCTCGGTTACTACAATCCCTTACCAGGTCAAGATGGTGGCAAGAGAATGGGTCTCAACTTCGACAGAGTGAAGTATTGGCTTTCTGTTGGAGCTCAGCCTTCAGAGCCCGTGGAGCGGCTTCTATTTCGAGCTGGAATGCTGCCCCCACCGCCCATGGTGGCAATGGGGCGTAAAGGTGGACCACGTGATACTCGCCCTGTCGATGCTCTTACAGGACGTGTCCTGCATCAAGAGAAGCCAGCTGATGCCAATAACACTGAGCAGCAGCATGACACTCCTGAAAACCCTTAA
Predicted protein sequences of Glyma.09g064500
>Glyma.09g064500.1.p sequence-type=predicted peptide transcript=Glyma.09g064500.1 locus=Glyma.09g064500 ID=Glyma.09g064500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVVRIRLSRLGCKNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDGGKRMGLNFDRVKYWLSVGAQPSEPVERLLFRAGMLPPPPMVAMGRKGGPRDTRPVDALTGRVLHQEKPADANNTEQQHDTPENP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo