Report for Sequence Feature Glyma.09g040500
Feature Type: gene_model
Chromosome: Gm09
Start: 3370431
stop: 3371819
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.09g040500
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
GO:0006952 GO-bp
defense response
EnsemblGenomes N/A IEA
GO:0006952 GO-bp
defense response
JGI N/A IEA
GO:0009607 GO-bp
response to biotic stimulus
EnsemblGenomes N/A IEA
GO:0009607 GO-bp
response to biotic stimulus
JGI N/A IEA
PF00407 PFAM
Pathogenesis-related protein Bet v I family
JGI N/A IEA
Proteins Associated with Glyma.09g040500
Locus Gene Symbol Protein Name
PR10 pathogenesis-related protein 10
Expression Patterns of Glyma.09g040500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.09g040500
Paralog Evidence Comments
Glyma.15g145700 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.09g040500 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma09g04520 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.09g040500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.09g040500.1 sequence-type=CDS polypeptide=Glyma.09g040500.1.p locus=Glyma.09g040500 ID=Glyma.09g040500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGGTGTTGTTACTCAGATTTATGATACCCCTGCTGCTGTGCCTCCTACTAGGCTTTTCAAAGCCATGACATTAGATTTCCATAACCTCTTCCCAAAGCTTGTGGATAGCATCCACAGCATTGTTTTCACCCAAGGAAATGGTGGTCCTGGCACCATCAAGAAGATCACCACCATTGAAGGTGACAAAACCAAGTATGTGCTGCACAGAGTTGATGCAATTGATGAGGCTAACTTTGTATATAACTTCAGCATAACTGAGGGCACTGCCTTGGCTGACACATTGGAGAAGGTCTCATTCGAGAGCCAATTGGTGGAAGCTCCAAATGGAGGATCCATTAGGAAGGTAAGTGTCCAATTTTTCACCAAAGGCGATGCTACGCTTAGTGAGGAGGAGCTCACTGCCAACAAAGCCAAGATCCAAGGGCTTGTAAAGCTAGTTGAAGGGTACCTTTTGGCAAATCCTGATTATTGA
Predicted protein sequences of Glyma.09g040500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.09g040500.1.p sequence-type=predicted peptide transcript=Glyma.09g040500.1 locus=Glyma.09g040500 ID=Glyma.09g040500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MGVVTQIYDTPAAVPPTRLFKAMTLDFHNLFPKLVDSIHSIVFTQGNGGPGTIKKITTIEGDKTKYVLHRVDAIDEANFVYNFSITEGTALADTLEKVSFESQLVEAPNGGSIRKVSVQFFTKGDATLSEEELTANKAKIQGLVKLVEGYLLANPDY*