|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G16980.1 | AT | RNA polymerases M/15 Kd subunit | JGI | N/A | IEA |
| GO:0001193 | GO-bp | maintenance of transcriptional fidelity during DNA-templated transcription elongation from RNA polymerase II promoter | EnsemblGenomes | N/A | IEA |
| GO:0006283 | GO-bp | transcription-coupled nucleotide-excision repair | EnsemblGenomes | N/A | IEA |
| GO:0006351 | GO-bp | transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
| GO:0006351 | GO-bp | transcription, DNA-templated | JGI | N/A | IEA |
| GO:0006367 | GO-bp | transcription initiation from RNA polymerase II promoter | EnsemblGenomes | N/A | IEA |
| GO:0006379 | GO-bp | mRNA cleavage | EnsemblGenomes | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
| GO:0005665 | GO-cc | DNA-directed RNA polymerase II, core complex | EnsemblGenomes | N/A | IEA |
| GO:0005730 | GO-cc | nucleolus | EnsemblGenomes | N/A | IEA |
| GO:0003676 | GO-mf | nucleic acid binding | EnsemblGenomes | N/A | IEA |
| GO:0003676 | GO-mf | nucleic acid binding | JGI | N/A | IEA |
| GO:0003677 | GO-mf | DNA binding | JGI | N/A | IEA |
| GO:0003899 | GO-mf | DNA-directed 5'-3' RNA polymerase activity | EnsemblGenomes | N/A | IEA |
| GO:0003899 | GO-mf | DNA-directed RNA polymerase activity | JGI | N/A | IEA |
| GO:0008270 | GO-mf | zinc ion binding | EnsemblGenomes | N/A | IEA |
| GO:0008270 | GO-mf | zinc ion binding | JGI | N/A | IEA |
| GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
| KOG2691 | KOG | RNA polymerase II subunit 9 | JGI | N/A | IEA |
| PTHR11239 | Panther | DNA-DIRECTED RNA POLYMERASE | JGI | N/A | IEA |
| PF01096 | PFAM | Transcription factor S-II (TFIIS) | JGI | N/A | IEA |
| PF02150 | PFAM | RNA polymerases M/15 Kd subunit | JGI | N/A | IEA |
|
Glyma.09g037400 not represented in the dataset |
Glyma.09g037400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.15g142700 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma09g04220 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g037400.1 sequence-type=CDS polypeptide=Glyma.09g037400.1.p locus=Glyma.09g037400 ID=Glyma.09g037400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAGTGCCATGAAATTTTGCCGTGAATGCAATAACATTCTGTACCCTAAGGAAGACAGAGACCAGAAAGTTCTTCTCTTCGCTTGCCGCAACTGCGACCATCAGGAGGTTGCTGATAACTTCTGTGTGTATAGGAATGAGATACATCACTCTGTTGGAGAGCGCACTCAGGTGTTGCAGGATGTCGCTGCAGATCCAACGCTTCCTCGAACCAAGTCTGTTCGCTGCAGTCAATGCAATCATGGTGAAGCTGTCTTTTTCCAGGCAACTGCCAGAGGGGAAGAAGGAATGACACTTTTTTTCGTTTGCTGCAACCCAAACTGTGGACACAGATGGAGAGACTGA
>Glyma.09g037400.1.p sequence-type=predicted peptide transcript=Glyma.09g037400.1 locus=Glyma.09g037400 ID=Glyma.09g037400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MSAMKFCRECNNILYPKEDRDQKVLLFACRNCDHQEVADNFCVYRNEIHHSVGERTQVLQDVAADPTLPRTKSVRCSQCNHGEAVFFQATARGEEGMTLFFVCCNPNCGHRWRD*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||