SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.09G283300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.09G283300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.09G283300

Feature Type:gene_model
Chromosome:Gm09
Start:49890371
stop:49892024
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G08290.1AT mRNA splicing factor, thioredoxin-like U5 snRNP JGI N/AIEA
GO:0000245GO-bp spliceosomal complex assembly EnsemblGenomesN/AIEA
GO:0000398GO-bp mRNA splicing, via spliceosome EnsemblGenomesN/AIEA
GO:0045454GO-bp cell redox homeostasis JGI N/AIEA
GO:0005681GO-cc spliceosomal complex EnsemblGenomesN/AIEA
GO:0005681GO-cc spliceosomal complex JGI N/AIEA
GO:0005682GO-cc U5 snRNP EnsemblGenomesN/AIEA
GO:0046540GO-cc U4/U6 x U5 tri-snRNP complex EnsemblGenomesN/AIEA
KOG3414 KOG Component of the U4/U6.U5 snRNP/mitosis protein DIM1 JGI N/AIEA
PTHR12052Panther THIOREDOXIN-LIKE PROTEN 4A, 4B JGI N/AIEA
PF02966PFAM Mitosis protein DIM1 JGI N/AIEA

LocusGene SymbolProtein Name
DIM1 DIM 1-like protein

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.09G283300 not represented in the dataset

Glyma.09G283300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE


View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.



View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Corresponding NameAnnotation VersionEvidenceComments
Glyma.09g283300 Wm82.a4.v1ISS As supplied by JGI
Glyma09g42010 Wm82.a1.v1.1IGC As supplied by JGI


>Glyma.09g283300.1 sequence-type=CDS polypeptide=Glyma.09g283300.1.p locus=Glyma.09g283300 ID=Glyma.09g283300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGTCGTACCTGTTGCCTCACTTGCACTCTGGATGGGCCGTCGATCAAGCAATCCTCGCCGAAGAGGAGCGTCTCGTCGTCATCCGTTTCGGCCACGACTGGGACGAAACCTGCATGCAGATGGACGAGGTGTTGGCGTCAGTGGCGGAGACGATAAAGAACTTTGCGGTGATATACCTGGTGGACATAACGGAGGTGCCGGATTTCAACACCATGTACGAGCTCTACGACCCTTCCACGGTGATGTTCTTCTTCAGGAACAAGCACATCATGATTGATCTCGGAACCGGTAACAACAACAAGATCAACTGGGCTCTCAAGGACAAGCAGGAGTTCATCGACATTGTTGAGACCGTCTATCGTGGAGCCAGGAAGGGACGGGGTCTCGTCATCGCTCCCAAAGATTACTCCACCAAGTACCGTTACTAG

>Glyma.09g283300.1.p sequence-type=predicted peptide transcript=Glyma.09g283300.1 locus=Glyma.09g283300 ID=Glyma.09g283300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo