|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G10040.1 | AT | cytochrome c-2 | JGI | N/A | IEA |
| GO:0006122 | GO-bp | mitochondrial electron transport, ubiquinol to cytochrome c | EnsemblGenomes | N/A | IEA |
| GO:0006123 | GO-bp | mitochondrial electron transport, cytochrome c to oxygen | EnsemblGenomes | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0005739 | GO-cc | mitochondrion | EnsemblGenomes | N/A | IEA |
| GO:0005758 | GO-cc | mitochondrial intermembrane space | EnsemblGenomes | N/A | IEA |
| GO:0070469 | GO-cc | respiratory chain | EnsemblGenomes | N/A | IEA |
| GO:0005506 | GO-mf | iron ion binding | JGI | N/A | IEA |
| GO:0009055 | GO-mf | electron transfer activity | EnsemblGenomes | N/A | IEA |
| GO:0009055 | GO-mf | electron carrier activity | JGI | N/A | IEA |
| GO:0020037 | GO-mf | heme binding | EnsemblGenomes | N/A | IEA |
| GO:0020037 | GO-mf | heme binding | JGI | N/A | IEA |
| GO:0046872 | GO-mf | metal ion binding | EnsemblGenomes | N/A | IEA |
| KOG3453 | KOG | Cytochrome c | JGI | N/A | IEA |
| PTHR11961 | Panther | CYTOCHROME C | JGI | N/A | IEA |
| PF00034 | PFAM | Cytochrome c | JGI | N/A | IEA |
|
Glyma.09G246700 not represented in the dataset |
Glyma.09G246700 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.18g246300 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g246700 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma09g38230 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g246700.1 sequence-type=CDS polypeptide=Glyma.09g246700.1.p locus=Glyma.09g246700 ID=Glyma.09g246700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCGTCCTTCGATGAAGCTCCTCCCGGAAACTCCAAGAACGGCGAGAAGATCTTCAAAACCAAGTGCGCTCAGTGCCACACCGTCGACAAAGGTGCCGGCCACAAACAAGGACCCAATCTGAATGGTTTGTTTGGAAGACAATCTGGTACAACTCCTGGATATTCCTATTCTACTGCTAACAAAAACATGGCCGTGATTTGGGAGGAAAAGACCCTCTATGATTACTTGCTCAACCCCAAAAAGTATATTCCAGGAACGAAGATGGTATTTCCTGGTCTTAAGAAACCTCAGGAACGTGCAGATCTTATTGCATATCTTAAAGAATCTACTGCTTAA
>Glyma.09g246700.1.p sequence-type=predicted peptide transcript=Glyma.09g246700.1 locus=Glyma.09g246700 ID=Glyma.09g246700.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MASFDEAPPGNSKNGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTANKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||