|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G15093.1 | AT | catalytic LigB subunit of aromatic ring-opening dioxygenase family | JGI | N/A | IEA |
| GO:0006725 | GO-bp | cellular aromatic compound metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0006725 | GO-bp | cellular aromatic compound metabolic process | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0008198 | GO-mf | ferrous iron binding | EnsemblGenomes | N/A | IEA |
| GO:0008198 | GO-mf | ferrous iron binding | JGI | N/A | IEA |
| GO:0008270 | GO-mf | zinc ion binding | EnsemblGenomes | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | EnsemblGenomes | N/A | IEA |
| GO:0016491 | GO-mf | oxidoreductase activity | JGI | N/A | IEA |
| GO:0016701 | GO-mf | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen | EnsemblGenomes | N/A | IEA |
| PF02900 | PFAM | Catalytic LigB subunit of aromatic ring-opening dioxygenase | JGI | N/A | IEA |
| GN7V-47839 | SoyCyc9-rxn | stizolobate synthase | Plant Metabolic Network | ISS |
|
Glyma.09G157100 not represented in the dataset |
Glyma.09G157100 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.16g207800 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g157100 | Wm82.a4.v1 | ISS | As supplied by JGI |
>Glyma.09g157100.1 sequence-type=CDS polypeptide=Glyma.09g157100.1.p locus=Glyma.09g157100 ID=Glyma.09g157100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAAGAAAGACGTGTTTCCTCAAAACCCATTTCAATACTTGTCATCTCTGCTCACTGTGACACTGCAGTTCCATCCATCAACGTTGTTGACTCCGTCAACCACACCATCTATGATTTCTATAACTTCCCCGAACAAATGTACCAGCATAAATATCCTGCACCTGGAGCTCCACAATTGGCAAGAAGGGTGAAGGAACTGCTCATAAAATCTGGTTTCAGCCGTGTTGATGAAGATACAAAGCCAGGACTTGACCATGGTGCTAGGGTTCCTCTCTTTTTGATGTATCCAGAAGCTGACATCCCTGTTTGTCAGCTATCTGTTCAATCTCAGCAAGATGGAACTTACCATTATAACTTTGGAAAGGCATTGGCACCTCTTAAAGATGAAAGTGTTTTGATTATTGGTTCTGGAAGTGCTATCCTGCACCTGGAGCTCCCTGGGCTTTAG
>Glyma.09g157100.1.p sequence-type=predicted peptide transcript=Glyma.09g157100.1 locus=Glyma.09g157100 ID=Glyma.09g157100.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MEERRVSSKPISILVISAHCDTAVPSINVVDSVNHTIYDFYNFPEQMYQHKYPAPGAPQLARRVKELLIKSGFSRVDEDTKPGLDHGARVPLFLMYPEADIPVCQLSVQSQQDGTYHYNFGKALAPLKDESVLIIGSGSAILHLELPGL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||