|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G19940.1 | AT | oxidoreductases, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor;copper ion binding | JGI | N/A | IEA |
| PTHR14097 | Panther | FAMILY NOT NAMED | JGI | N/A | IEA |
| PTHR14097:SF7 | Panther | OXIDOREDUCTASE HTATIP2 | JGI | N/A | IEA |
| ARGSYN-PWY | SoyCyc9 | L-arginine biosynthesis I (via L-ornithine) | Plant Metabolic Network | ISS | |
| ARGSYNBSUB-PWY | SoyCyc9 | L-arginine biosynthesis II (acetyl cycle) | Plant Metabolic Network | ISS | |
| GLUTORN-PWY | SoyCyc9 | L-ornithine biosynthesis I | Plant Metabolic Network | ISS | |
| GN7V-65611 | SoyCyc9-rxn | N-acetyl-γ-glutamyl-phosphate reductase | Plant Metabolic Network | ISS |
|
Glyma.09G127500 not represented in the dataset |
Glyma.09G127500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
>Glyma.09g127500.1 sequence-type=CDS polypeptide=Glyma.09g127500.1.p locus=Glyma.09g127500 ID=Glyma.09g127500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGACGAGTTTTCTTAGTATTGAGCTTAAAAATATTATCATTGATGCTAAACCTGTTGTGAGTGGAGCAGGATGTAGTGCCAAAGAAAATTTATTGTTCACTGAAGACGAAGAATTTGTTGTTGTGTTGGAAAATGGAGCCATTCCTCGAACTCATAGGGTTAAAGGGACTAATTATTGTTTAATCAATGTTTTTCCAAACCGAATTCCTGGAAGAGCAATCATTATATCTGTTATTGATAATTTAGTGAAGGGAGCTTTAGATCAAGCTTTACAAAACCTTAATTTGTTAATGGGATTTCCAGAAAATTTGGGACTTCATTACCTGCCTCTTTTTCCTTAG
>Glyma.09g127500.1.p sequence-type=predicted peptide transcript=Glyma.09g127500.1 locus=Glyma.09g127500 ID=Glyma.09g127500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MTSFLSIELKNIIIDAKPVVSGAGCSAKENLLFTEDEEFVVVLENGAIPRTHRVKGTNYCLINVFPNRIPGRAIIISVIDNLVKGALDQALQNLNLLMGFPENLGLHYLPLFP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||