|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G42650.1 | AT | allene oxide synthase | JGI | N/A | IEA |
| GO:0055114 | GO-bp | oxidation-reduction process | EnsemblGenomes | N/A | IEA |
| GO:0005506 | GO-mf | iron ion binding | EnsemblGenomes | N/A | IEA |
| GO:0016705 | GO-mf | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | EnsemblGenomes | N/A | IEA |
| GO:0020037 | GO-mf | heme binding | EnsemblGenomes | N/A | IEA |
| PWY-735 | SoyCyc9 | jasmonic acid biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-65830 | SoyCyc9-rxn | hydroperoxide dehydratase | Plant Metabolic Network | ISS |
|
Glyma.09G114800 not represented in the dataset |
Glyma.09G114800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
>Glyma.09g114800.1 sequence-type=CDS polypeptide=Glyma.09g114800.1.p locus=Glyma.09g114800 ID=Glyma.09g114800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGCATCCTCAGCCTCCACCACGCTCTCCTCTCCCTTCCTTCGACTAGAATTACCCTCCACAACAATAAAACCATGTTCATCAATTATTTCTGTTCCCTCCATCAGAGCCTCTGTCTCCGAGAAACCACCGCTACCAGCTGTGTCGGTTACCTCCCTTGAGCCCAATCCACAAAATTCCCGGCGACTGCGGCTTCCCGGCCGTGACGAGTTCTGCAAGTCCTGCATCCAAAAGTACCAGTCAACTGTCTTCCGTACCAACATGCCACCTGGCCCCTTCCTCGCCCCCAACCCAAATGTTATCGTTCTCCTCGACGTGAAAACCTTCCCCATCCTCTTCGACAACTCCAAGATCGACAAAAAAGATGTTTTCACTTGCACCTGTTAG
>Glyma.09g114800.1.p sequence-type=predicted peptide transcript=Glyma.09g114800.1 locus=Glyma.09g114800 ID=Glyma.09g114800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MASSASTTLSSPFLRLELPSTTIKPCSSIISVPSIRASVSEKPPLPAVSVTSLEPNPQNSRRLRLPGRDEFCKSCIQKYQSTVFRTNMPPGPFLAPNPNVIVLLDVKTFPILFDNSKIDKKDVFTCTC*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||