|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G20330.1 | AT | PYRIMIDINE B | JGI | N/A | IEA |
| GO:0006207 | GO-bp | 'de novo' pyrimidine nucleobase biosynthetic process | EnsemblGenomes | N/A | IEA |
| GO:0006520 | GO-bp | cellular amino acid metabolic process | EnsemblGenomes | N/A | IEA |
| GO:0006520 | GO-bp | cellular amino acid metabolic process | JGI | N/A | IEA |
| GO:0004070 | GO-mf | aspartate carbamoyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0016597 | GO-mf | amino acid binding | EnsemblGenomes | N/A | IEA |
| GO:0016743 | GO-mf | carboxyl- or carbamoyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0016743 | GO-mf | carboxyl- or carbamoyltransferase activity | JGI | N/A | IEA |
| PTHR11405 | Panther | CARBAMOYLTRANSFERASE RELATED | JGI | N/A | IEA |
| PF02729 | PFAM | Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain | JGI | N/A | IEA |
| PWY-5686 | SoyCyc9 | UMP biosynthesis I | Plant Metabolic Network | ISS | |
| PWY-7211 | SoyCyc9 | superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| PWY0-162 | SoyCyc9 | superpathway of pyrimidine ribonucleotides de novo biosynthesis | Plant Metabolic Network | ISS | |
| GN7V-48279 | SoyCyc9-rxn | aspartate carbamoyltransferase | Plant Metabolic Network | ISS |
|
Glyma.09G110200 not represented in the dataset |
Glyma.09G110200 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g110200 | Wm82.a4.v1 | ISS | As supplied by JGI |
>Glyma.09g110200.1 sequence-type=CDS polypeptide=Glyma.09g110200.1.p locus=Glyma.09g110200 ID=Glyma.09g110200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGAGAACAGTGGGTGGAGAGGTTCTAACTACTGAAAATGCGAGAGAATTTTCATCTGCAGCAAAAGGAGAGACACTTGAAGATACAATCAGAACAATTGAGGGTTACTCTGATATAATTGTGATGCGGCATTTTGAAAGTGGTGCTGCCAGAAGAACTGCAGCTACATCTGACATTCCAATAATCAATGCAGGGGATGATCCTGGACAGCATCCGACTCAGTTATGCCTAAAATAG
>Glyma.09g110200.1.p sequence-type=predicted peptide transcript=Glyma.09g110200.1 locus=Glyma.09g110200 ID=Glyma.09g110200.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MRTVGGEVLTTENAREFSSAAKGETLEDTIRTIEGYSDIIVMRHFESGAARRTAATSDIPIINAGDDPGQHPTQLCLK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||