|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G63160.1 | AT | BTB and TAZ domain protein 1 | JGI | N/A | IEA |
| GO:0006355 | GO-bp | regulation of transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
| GO:0006355 | GO-bp | regulation of transcription, DNA-templated | JGI | N/A | IEA |
| GO:0016573 | GO-bp | histone acetylation | EnsemblGenomes | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | JGI | N/A | IEA |
| GO:0003712 | GO-mf | transcription cofactor activity | EnsemblGenomes | N/A | IEA |
| GO:0003712 | GO-mf | transcription cofactor activity | JGI | N/A | IEA |
| GO:0004402 | GO-mf | histone acetyltransferase activity | EnsemblGenomes | N/A | IEA |
| GO:0004402 | GO-mf | histone acetyltransferase activity | JGI | N/A | IEA |
| GO:0008270 | GO-mf | zinc ion binding | EnsemblGenomes | N/A | IEA |
| GO:0008270 | GO-mf | zinc ion binding | JGI | N/A | IEA |
| PF02135 | PFAM | TAZ zinc finger | JGI | N/A | IEA |
|
Glyma.09G098400 not represented in the dataset |
Glyma.09G098400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g098400 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma09g14560 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g098400.1 sequence-type=CDS polypeptide=Glyma.09g098400.1.p locus=Glyma.09g098400 ID=Glyma.09g098400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAGTGTTTGGAGCACATATGCTATGATGGGTGTACCCACGTTGAACCGTACGATGCTGCGGAGGTGAAGAGGGAGAGGACTCCGTGTGGAAGAATCGCCACGTGCCAGGCTCTTCAGGTTCTGATCCGCCACTTTGCCACGTGCGAGAAGAAGGTGCGCGGCGGCTGCGTGCGGTGCAAGCGAATGTTGCAGCTCTTTCGACTCCATTCCTATCTTTGTCACCACACCGATTCATCCTGCAAGGTTCCTTTTTTGCCGGGCCTTTTGAGATTACTTCTTCTGCATGGAACAATTAGTTGA
>Glyma.09g098400.1.p sequence-type=predicted peptide transcript=Glyma.09g098400.1 locus=Glyma.09g098400 ID=Glyma.09g098400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MECLEHICYDGCTHVEPYDAAEVKRERTPCGRIATCQALQVLIRHFATCEKKVRGGCVRCKRMLQLFRLHSYLCHHTDSSCKVPFLPGLLRLLLLHGTIS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||