|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G23230.1 | AT | Integrase-type DNA-binding superfamily protein | JGI | N/A | IEA |
| GO:0006351 | GO-bp | transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
| GO:0006355 | GO-bp | regulation of transcription, DNA-templated | EnsemblGenomes | N/A | IEA |
| GO:0006355 | GO-bp | regulation of transcription, DNA-templated | JGI | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
| GO:0003677 | GO-mf | DNA binding | EnsemblGenomes | N/A | IEA |
| GO:0003700 | GO-mf | DNA binding transcription factor activity | EnsemblGenomes | N/A | IEA |
| GO:0003700 | GO-mf | sequence-specific DNA binding transcription factor activity | JGI | N/A | IEA |
| PF00847 | PFAM | AP2 domain | JGI | N/A | IEA |
| Locus | Gene Symbol | Protein Name |
|---|---|---|
| ERF69 | Ethylene-responsive factor gene 69 |
|
Glyma.09G052800 not represented in the dataset |
Glyma.09G052800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.15g159100 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g052800 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma09g05840 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g052800.1 sequence-type=CDS polypeptide=Glyma.09g052800.1.p locus=Glyma.09g052800 ID=Glyma.09g052800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGGAAAAGAGTGTTAAGAAAGAAGCTAACCGAGGCCCATGGGGTAAGTTCGGAGCAGAGATCAGAGACCCAACGAAACCTACAGGAAGACAATGGTTAGGAACATTTGACACGGCGGAAGAAGCTGCTAGAGCTTATGATCGTGCAGCCATTGAATTGAGGGGTGTTCTTGCAATCCTTAATTTTCCAGATGAGTGCTATTCTCAACTCCCTTTTGTATCATCAAACCCTACTAGTACGGCTAATGGAAGTTCTTTTGCTCCAACACATAAGGAAGTTATTGAGTTTGAGTGTTTGGATAACAAGGTGTTGGAAGACCTTCTTGAGTCCGAAGTGAAAAGAAGGAACGAAGACTAA
>Glyma.09g052800.1.p sequence-type=predicted peptide transcript=Glyma.09g052800.1 locus=Glyma.09g052800 ID=Glyma.09g052800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MEKSVKKEANRGPWGKFGAEIRDPTKPTGRQWLGTFDTAEEAARAYDRAAIELRGVLAILNFPDECYSQLPFVSSNPTSTANGSSFAPTHKEVIEFECLDNKVLEDLLESEVKRRNED*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||