|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G44520.1 | AT | NagB/RpiA/CoA transferase-like superfamily protein | JGI | N/A | IEA |
| GO:0009052 | GO-bp | pentose-phosphate shunt, non-oxidative branch | EnsemblGenomes | N/A | IEA |
| GO:0009052 | GO-bp | pentose-phosphate shunt, non-oxidative branch | JGI | N/A | IEA |
| GO:0004751 | GO-mf | ribose-5-phosphate isomerase activity | EnsemblGenomes | N/A | IEA |
| GO:0004751 | GO-mf | ribose-5-phosphate isomerase activity | JGI | N/A | IEA |
| PTHR11934 | Panther | RIBOSE-5-PHOSPHATE ISOMERASE | JGI | N/A | IEA |
| PF06026 | PFAM | Ribose 5-phosphate isomerase A (phosphoriboisomerase A) | JGI | N/A | IEA |
| CALVIN-PWY | SoyCyc9 | Calvin-Benson-Bassham cycle | Plant Metabolic Network | ISS | |
| NONOXIPENT-PWY | SoyCyc9 | pentose phosphate pathway (non-oxidative branch) | Plant Metabolic Network | ISS | |
| PENTOSE-P-PWY | SoyCyc9 | pentose phosphate pathway | Plant Metabolic Network | ISS | |
| PHOTOALL-PWY | SoyCyc9 | oxygenic photosynthesis | Plant Metabolic Network | ISS | |
| PWY-5723 | SoyCyc9 | Rubisco shunt | Plant Metabolic Network | ISS | |
| GN7V-65029 | SoyCyc9-rxn | ribose-5-phosphate isomerase | Plant Metabolic Network | ISS |
|
Glyma.09G030500 not represented in the dataset |
Glyma.09G030500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.15g136200 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.09g030500 | Wm82.a4.v1 | ISS | As supplied by JGI |
| Glyma09g03511 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g030500.1 sequence-type=CDS polypeptide=Glyma.09g030500.1.p locus=Glyma.09g030500 ID=Glyma.09g030500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGACAATTGCTGAAGAGATTGATGATATGTTTCTGGGTGATGCTGAGGTCTGGAGAAGACCATCTATAGGGCAAGCAGGTCCACTAGGAGGTGACTTCCCAGTAGTCACCAGCGAAGGACATAATATTCCTGATGTTATCTTTACATCTCCAATAGAAAACCTTGCTGAAGTAGCAAAATGCCTTGATAAAGTTGATGGTGTTGTGGACCATGGTGTCGTATCTAAAGTCCCATGCACAGTTGTAATTGCTTCTCAGACTGGACTGAAAATTTTGGACAAACTAACTGCAGATATAGTGGGTTAG
>Glyma.09g030500.1.p sequence-type=predicted peptide transcript=Glyma.09g030500.1 locus=Glyma.09g030500 ID=Glyma.09g030500.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MTIAEEIDDMFLGDAEVWRRPSIGQAGPLGGDFPVVTSEGHNIPDVIFTSPIENLAEVAKCLDKVDGVVDHGVVSKVPCTVVIASQTGLKILDKLTADIVG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||