|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G04180.1 | AT | P-loop containing nucleoside triphosphate hydrolases superfamily protein | JGI | N/A | IEA |
| GO:0030433 | GO-bp | ubiquitin-dependent ERAD pathway | EnsemblGenomes | N/A | IEA |
| GO:0045899 | GO-bp | positive regulation of RNA polymerase II transcriptional preinitiation complex assembly | EnsemblGenomes | N/A | IEA |
| GO:1901800 | GO-bp | positive regulation of proteasomal protein catabolic process | EnsemblGenomes | N/A | IEA |
| GO:0008540 | GO-cc | proteasome regulatory particle, base subcomplex | EnsemblGenomes | N/A | IEA |
| GO:0031595 | GO-cc | nuclear proteasome complex | EnsemblGenomes | N/A | IEA |
| GO:0031597 | GO-cc | cytosolic proteasome complex | EnsemblGenomes | N/A | IEA |
| GO:0005524 | GO-mf | ATP binding | EnsemblGenomes | N/A | IEA |
| GO:0017025 | GO-mf | TBP-class protein binding | EnsemblGenomes | N/A | IEA |
| GO:0036402 | GO-mf | proteasome-activating ATPase activity | EnsemblGenomes | N/A | IEA |
| PTHR23073 | Panther | 26S PROTEASE REGULATORY SUBUNIT | JGI | N/A | IEA |
| PTHR23073:SF18 | Panther | SUBFAMILY NOT NAMED | JGI | N/A | IEA |
| GN7V-66164 | SoyCyc9-rxn | Vesicle-fusing ATPase | Plant Metabolic Network | ISS |
|
Glyma.09G007800 not represented in the dataset |
Glyma.09G007800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.15g112100 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma09g01031 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
>Glyma.09g007800.1 sequence-type=CDS polypeptide=Glyma.09g007800.1.p locus=Glyma.09g007800 ID=Glyma.09g007800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGTCTGAGTTCTACGGTAAAAGTGAACGTCTTCTAGGGAAAGTGTTATCGCTTGCGAACACTCTTCCTAATGCGATACAGATTGATTCTTTTGCTGCTGCTCGTGACAATGAAATGCATGAAGCTACACGTAGAATATTGTCAGTCTTGTTGCGACAGTTTAATCTTGTTGGTTACTGTTTAAGATACACAGAATGGCATGTTATATACCTTTTGTCTATAGAAATTGATTGTGTGCTAGAGTTTTAG
>Glyma.09g007800.1.p sequence-type=predicted peptide transcript=Glyma.09g007800.1 locus=Glyma.09g007800 ID=Glyma.09g007800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MSEFYGKSERLLGKVLSLANTLPNAIQIDSFAAARDNEMHEATRRILSVLLRQFNLVGYCLRYTEWHVIYLLSIEIDCVLEF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||