Report for Sequence Feature Glyma.08g348200
| Feature Type: | gene_model |
| Chromosome: | Gm08 |
| Start: | 45634929 |
| stop: | 45636629 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.08g348200
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT3G07230.1 | AT |
|
JGI | N/A | IEA |
| PTHR36752 | PantherFam |
OS12G0405700 PROTEIN |
JGI | N/A | IEA |
| PF08186 | Pfam |
Wound-inducible basic protein family |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.08g348200 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma08g46240 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.08g348200
>Glyma.08g348200.3 sequence-type=CDS polypeptide=Glyma.08g348200.3.p locus=Glyma.08g348200 id=Glyma.08g348200.3.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGATTTACGACGTTAACTCTCCTCTTTTCCGATCCTTCCTCAGCCAGAAGGGAGGCTCCTCTGATAAGAGGAAATCGGACGAACAGAAGCCAAAAGAGCAGAAACCCAAAGCCAGCGAGAACAAACCTATAATGACTGAGTGA
Predicted protein sequences of Glyma.08g348200
>Glyma.08g348200.3.p sequence-type=predicted peptide transcript=Glyma.08g348200.3 locus=Glyma.08g348200 id=Glyma.08g348200.3.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MIYDVNSPLFRSFLSQKGGSSDKRKSDEQKPKEQKPKASENKPIMTE*