SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma.08g301300

Feature Type:gene_model
Chromosome:Gm08
Start:41931888
stop:41933603
Source:JGI
Version:Wm82.a2.v1
High confidence:yes



A previous version of this gene model can be found here:

Annotations for Glyma.08g301300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G26880.1AT Ribosomal protein L34e superfamily protein JGI N/AIEA
GO:0006412GO-bp translation EnsemblGenomesN/AIEA
GO:0006412GO-bp translation JGI N/AIEA
GO:0042254GO-bp ribosome biogenesis EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular EnsemblGenomesN/AIEA
GO:0005622GO-cc intracellular JGI N/AIEA
GO:0005840GO-cc ribosome EnsemblGenomesN/AIEA
GO:0005840GO-cc ribosome JGI N/AIEA
GO:0022625GO-cc cytosolic large ribosomal subunit EnsemblGenomesN/AIEA
GO:0003723GO-mf RNA binding EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome EnsemblGenomesN/AIEA
GO:0003735GO-mf structural constituent of ribosome JGI N/AIEA
KOG1790 KOG 60s ribosomal protein L34 JGI N/AIEA
PTHR10759Panther 60S RIBOSOMAL PROTEIN L34 JGI N/AIEA
PF01199PFAM Ribosomal protein L34e JGI N/AIEA

Expression Patterns of Glyma.08g301300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

View a gene family containing related genes from other legumes at LIS

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.


View gene and ortholog information at GlycineMine

Gene information in GlycineMine developed by LIS.


Related Plant Genes

View a gene family containing related genes from other plant species at PhyloGenes

Gene families from PhyloGenes.


Paralogs of Glyma.08g301300
ParalogEvidenceComments
Glyma.18g119100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.

Gene model name correspondences to Glyma.08g301300 Gene Call Version Wm82.a2.v1
Corresponding NameAnnotation VersionEvidenceComments
Glyma08g41280 Wm82.a1.v1.1IGC As supplied by JGI


Coding sequences of Glyma.08g301300
>Glyma.08g301300.1 sequence-type=CDS polypeptide=Glyma.08g301300.1.p locus=Glyma.08g301300 ID=Glyma.08g301300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGCAGCGTCTCACCTACCGCAAGCGCCACAGCTATGCCACCAAATCCAACCAGCACAGAGTCGTCAAGACTCCCGGTGGCAAGCTTGTTTATCAGACCACGAAGAAGAGGGCCAGCGGACCCAAGTGCCCTGTCACTGGAAAGAGGATTCAAGGGATTCCACATTTAAGGCCAACAGAATATAAGAGATCAAGGTTACCCAAAAACCGAAGGACTGTGAACCGTGCATATGGTGGTGTGTTGTCTGGCAGTGCTGTTAGAGAGAGAATCATTCGAGCTTTCTTGGTTGAAGAGCAAAAGATTGTGAAAAAGGTATTGAAGATCCAAAAGACAAAGGAAAAGCAAGCTTTGAAGGGCTGA
Predicted protein sequences of Glyma.08g301300
>Glyma.08g301300.1.p sequence-type=predicted peptide transcript=Glyma.08g301300.1 locus=Glyma.08g301300 ID=Glyma.08g301300.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPTEYKRSRLPKNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQKIVKKVLKIQKTKEKQALKG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo