Report for Sequence Feature Glyma.08g254400
Feature Type: gene_model
Chromosome: Gm08
Start: 22496766
stop: 22497817
Source: JGI
Version: Wm82.a2.v1
High confidence: yes
A previous version of this gene model can be found here:
Annotations for Glyma.08g254400
Proteins Associated with Glyma.08g254400
Locus Gene Symbol Protein Name
BZIP73B BZIP transcription factor
bZIP67 Basic leucine zipper transcription factor-like protein gene 67
Expression Patterns of Glyma.08g254400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Related Legume Genes
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS .
Gene information in GlycineMine developed by LIS .
Related Plant Genes
Gene families from PhyloGenes .
Paralogs of Glyma.08g254400
Paralog Evidence Comments
Glyma.18g277100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35.
Gene model name correspondences to Glyma.08g254400 Gene Call Version Wm82.a2.v1
Corresponding Name Annotation Version Evidence Comments
Glyma08g28220 Wm82.a1.v1.1 IGC As supplied by JGI
Coding sequences of Glyma.08g254400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma.08g254400.1 sequence-type=CDS polypeptide=Glyma.08g254400.1.p locus=Glyma.08g254400 ID=Glyma.08g254400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGCAGGCCAGGGAGATCACAGGACTCAATTATTTACTCCCTCCAGACCCTTGTTTCAACTACAGCATGGTTCAGAACACCATCCCCACATTTCAACTCCACAAACTCTCAAACCAATTCTATGGTTTGCAGAAACCTCCTCCTCAAGTGCTTGCAGACTTCAGCCCCCCTCAGTCCTCATGCATCAGCAGCAACTCAACCTCTGATGAAGCAGATGAGCAGCAGCAAAGCCTCATCAATGAGAGGAAGCACAGGAGGATGATATCGAACCGCGAATCGGCACGCCGGTCACGCATGAGGAAGCAGAAGCACCTTGATGAGCTGTGGTCACAGGTGGTTTGGCTCAGGAATGAAAATCACCAGCTCATGGACAAGCTGAACCATGTGTCTGAGTCACATGATAAAGTTGCTCAAGAGAATGTTCAGCTGAGAGAAGAAGCCTCAGAACTTCGCCAAATGATATGTGACATGCAGCTACACAGTCCATACCACCCTCCTCCCTTGAGTCCCATTGATGATGATGTTTCTCCCTATGTCAAATCTGATTCCTCAATCACAGACTCTTTGGACCTGCTTGGTTGA
Predicted protein sequences of Glyma.08g254400
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma.08g254400.1.p sequence-type=predicted peptide transcript=Glyma.08g254400.1 locus=Glyma.08g254400 ID=Glyma.08g254400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MQAREITGLNYLLPPDPCFNYSMVQNTIPTFQLHKLSNQFYGLQKPPPQVLADFSPPQSSCISSNSTSDEADEQQQSLINERKHRRMISNRESARRSRMRKQKHLDELWSQVVWLRNENHQLMDKLNHVSESHDKVAQENVQLREEASELRQMICDMQLHSPYHPPPLSPIDDDVSPYVKSDSSITDSLDLLG*