Report for Sequence Feature Glyma.08g228500
| Feature Type: | gene_model |
| Chromosome: | Gm08 |
| Start: | 18709444 |
| stop: | 18709919 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.08g228500
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT2G28355.1 | AT |
LCR5 |
JGI | N/A | IEA |
| PF07333 | Pfam |
S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP) |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.08g228500 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
Coding sequences of Glyma.08g228500
>Glyma.08g228500.2 sequence-type=CDS polypeptide=Glyma.08g228500.2.p locus=Glyma.08g228500 id=Glyma.08g228500.2.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGAAGGACATCACTTTTGTTTTTATTGTTCTGTTGGTTCTTTCCATTGGAATTGAAAATGAAGGGCCATTGAAGTTGATAGAAGCAAGAACGTGCGAAGAAACACTGTATGAGTTTAGTTGTGTAAGTAACAAATGTGACACTGATTGTCGCAATAAACATGGAAACTTTGCAAGTGGTGATTGCAATGCCATTGAAGATTGCATATGTCGCTATCCATGTTAA
Predicted protein sequences of Glyma.08g228500
>Glyma.08g228500.2.p sequence-type=predicted peptide transcript=Glyma.08g228500.2 locus=Glyma.08g228500 id=Glyma.08g228500.2.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MKDITFVFIVLLVLSIGIENEGPLKLIEARTCEETLYEFSCVSNKCDTDCRNKHGNFASGDCNAIEDCICRYPC*