Report for Sequence Feature Glyma.08g219600
| Feature Type: | gene_model |
| Chromosome: | Gm08 |
| Start: | 17931964 |
| stop: | 17932119 |
| Source: | JGI |
| Version: | Wm82.a4.v1 |
| High confidence: | yes |
| 
|
Annotations for Glyma.08g219600
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
| AT2G35736.2 | AT |
|
JGI | N/A | IEA |
| PTHR33528 | PantherFam |
OS07G0239500 PROTEIN |
JGI | N/A | IEA |
| PF15054 | Pfam |
Domain of unknown function (DUF4535) |
JGI | N/A | IEA |
Gene model name correspondences to Glyma.08g219600 Gene Call Version Wm82.a4.v1
| Corresponding Name | Annotation Version | Evidence | Comments |
| Glyma08g23487 | Wm82.a1.v1.1 | IGC | As supplied by JGI |
Coding sequences of Glyma.08g219600
>Glyma.08g219600.1 sequence-type=CDS polypeptide=Glyma.08g219600.1.p locus=Glyma.08g219600 id=Glyma.08g219600.1.Wm82.a4.v1 annot-version=Wm82.a4.v1
ATGGGTATAATCAGGAGTTGCTTCTCTTTCATTGCAGGGACGGTCTTTGGGATTTACGTGGCTCAAAGTTATCAAGTTCCTGACGTCAAGAAGGAAGCTGACACTGCCTTGTTACAGGCAAAGCAAGTTGAGGAAAAATATCGCAAGTCCAAGTAA
Predicted protein sequences of Glyma.08g219600
>Glyma.08g219600.1.p sequence-type=predicted peptide transcript=Glyma.08g219600.1 locus=Glyma.08g219600 id=Glyma.08g219600.1.p.Wm82.a4.v1 annot-version=Wm82.a4.v1
MGIIRSCFSFIAGTVFGIYVAQSYQVPDVKKEADTALLQAKQVEEKYRKSK*