|
A previous version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G80100.1 | AT | histidine phosphotransfer protein 6 | JGI | N/A | IEA |
| GO:0000160 | GO-bp | phosphorelay signal transduction system | EnsemblGenomes | N/A | IEA |
| GO:0000160 | GO-bp | phosphorelay signal transduction system | JGI | N/A | IEA |
| GO:0009736 | GO-bp | cytokinin-activated signaling pathway | EnsemblGenomes | N/A | IEA |
| GO:0016310 | GO-bp | phosphorylation | EnsemblGenomes | N/A | IEA |
| GO:0005622 | GO-cc | intracellular | EnsemblGenomes | N/A | IEA |
| GO:0005634 | GO-cc | nucleus | EnsemblGenomes | N/A | IEA |
| GO:0005737 | GO-cc | cytoplasm | EnsemblGenomes | N/A | IEA |
| GO:0004871 | GO-mf | signal transducer activity | EnsemblGenomes | N/A | IEA |
| GO:0004871 | GO-mf | signal transducer activity | JGI | N/A | IEA |
| GO:0009927 | GO-mf | histidine phosphotransfer kinase activity | EnsemblGenomes | N/A | IEA |
| GO:0043424 | GO-mf | protein histidine kinase binding | EnsemblGenomes | N/A | IEA |
| KOG4747 | KOG | Two-component phosphorelay intermediate involved in MAP kinase cascade regulation | JGI | N/A | IEA |
| PF01627 | PFAM | Hpt domain | JGI | N/A | IEA |
|
Glyma.08g212800 not represented in the dataset |
Glyma.08g212800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.
Gene information in GlycineMine developed by LIS.
Gene families from PhyloGenes.
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma.07g030100 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.35. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
>Glyma.08g212800.1 sequence-type=CDS polypeptide=Glyma.08g212800.1.p locus=Glyma.08g212800 ID=Glyma.08g212800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 ATGCTTGGTTTGGGTGCGGACCTCTTGTGGGCCGACATGAACCGTCTCCTCGCCTTTCTCTTCCACCAGGGAGTGTTGGATGAGCAATTCTTGCAGCTTCAGCAGCTGCAGGATGAGACCTCCCCAAACTTCGTCTCCGAGGTTGTCAACATTTATTTCCACGAATCCGAAAAGCTTCTCAGAAATCTCAGAGCTTTGCTGATGGAGAAGGAGTTTTCGGACTATAAGAAAATGGGGATCCATTTGAATCAGTTCATGGGTAGCAGTTCCAGTATTGGCGCCAAGAGAGTTAGAAATGTTTGCGTTGCCTTTCGTGCCGCTACTGAACAGAATAACCGTGCTGGTTGCTTGCGAGCGTTGGAGATGCTGGAGCATGAATATTGCTATCTCAAGAACAAATTGCACGAATTGTTCCAAATTGAACAGCAACGTGCTTTGGCCGCAGGAGTAAGGTACCCGGTGCAGAATTAA
>Glyma.08g212800.1.p sequence-type=predicted peptide transcript=Glyma.08g212800.1 locus=Glyma.08g212800 ID=Glyma.08g212800.1.Wm82.a2.v1 annot-version=Wm82.a2.v1 MLGLGADLLWADMNRLLAFLFHQGVLDEQFLQLQQLQDETSPNFVSEVVNIYFHESEKLLRNLRALLMEKEFSDYKKMGIHLNQFMGSSSSIGAKRVRNVCVAFRAATEQNNRAGCLRALEMLEHEYCYLKNKLHELFQIEQQRALAAGVRYPVQN*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||