Glyma.08g206400

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma.08g206400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma.08g206400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma.08g206400

Feature Type:	gene_model
Chromosome:	Gm08
Start:	16686954
stop:	16690055
Source:	JGI
Version:	Wm82.a2.v1
High confidence:	yes

A previous version of this gene model can be found here:

Annotations for Glyma.08g206400

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G52330.2	AT	Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family	JGI	N/A	IEA
GO:0016020	GO-cc	membrane	EnsemblGenomes	N/A	IEA
GO:0016021	GO-cc	integral component of membrane	EnsemblGenomes	N/A	IEA
ARGSYN-PWY	SoyCyc9	L-arginine biosynthesis I (via L-ornithine)	Plant Metabolic Network		ISS
ARGSYNBSUB-PWY	SoyCyc9	L-arginine biosynthesis II (acetyl cycle)	Plant Metabolic Network		ISS
CITRULLINE-DEG-PWY	SoyCyc9	L-citrulline degradation	Plant Metabolic Network		ISS
PWY-4984	SoyCyc9	urea cycle	Plant Metabolic Network		ISS
PWY-7060	SoyCyc9	ornithine-citrulline shuttle	Plant Metabolic Network		ISS
GN7V-66191	SoyCyc9-rxn	ornithine carbamoyltransferase	Plant Metabolic Network		ISS

Expression Patterns of Glyma.08g206400

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma.08g206400 not represented in the dataset	Glyma.08g206400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Related Legume Genes

Gene families from Phytozome are displayed using the PhyloTree viewer developed by LIS.

Gene information in GlycineMine developed by LIS.

Related Plant Genes

Gene families from PhyloGenes.

Gene model name correspondences to Glyma.08g206400 Gene Call Version Wm82.a2.v1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma08g22050	Wm82.a1.v1.1	IGC	As supplied by JGI

Coding sequences of Glyma.08g206400

Limit To All Plant Sequences

>Glyma.08g206400.1 sequence-type=CDS polypeptide=Glyma.08g206400.1.p locus=Glyma.08g206400 ID=Glyma.08g206400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
ATGGTGAAGGCATTCTCATCAAACTGCGTGGTTTTGAGACGGTTTTGCTGCCTGAAATGGACGGTGTTTGTGGTGGTGTCTCTGGCGGGCGTGTTGGTGTTATGGCCGTGGGAGCCAGAGTTGAAGATCGAGAGAATGAACGTGAAGCGCGTGAAGGTGCACCCTATACCGCCGGTGAGCGCGGACGTGTGGATATCGCTGTCGGTGAGGGTACAGAACCGCTGCATGTACTGGATGGAGCTGACGGACGTTGACGTAGGGGTGAAGTACAGGGGGAAGAAGATGGGTCACGTGGAGTCGGAGGGGTGGCACGTGAGGGGGTGGGCGTCGACGAAGGTGGACGGCGTGCTTGAGTTCAGTGGCCTTCCATCGTCGGAGGTGGCGCATTTGCTGCAGGACCTTGCCATGGGTAAGATCTACTTCCATACCGTTATCAAGGTCTACGGCCAACTTGGCTTTCTCTTGTTTCGCATCCCTCATTTTCTCCAGCTCACGAAGAGACAATCGAACAGAAAAAAAGATGCATGA

Predicted protein sequences of Glyma.08g206400

Limit To All Plant Sequences

>Glyma.08g206400.1.p sequence-type=predicted peptide transcript=Glyma.08g206400.1 locus=Glyma.08g206400 ID=Glyma.08g206400.1.Wm82.a2.v1 annot-version=Wm82.a2.v1
MVKAFSSNCVVLRRFCCLKWTVFVVVSLAGVLVLWPWEPELKIERMNVKRVKVHPIPPVSADVWISLSVRVQNRCMYWMELTDVDVGVKYRGKKMGHVESEGWHVRGWASTKVDGVLEFSGLPSSEVAHLLQDLAMGKIYFHTVIKVYGQLGFLLFRIPHFLQLTKRQSNRKKDA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain